Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 4699288..4700042 | Replicon | chromosome |
| Accession | NZ_CP126138 | ||
| Organism | Salmonella enterica subsp. enterica serovar Kottbus strain DSK01 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | B5F003 |
| Locus tag | QNM33_RS22945 | Protein ID | WP_000558166.1 |
| Coordinates | 4699288..4699599 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | QNM33_RS22950 | Protein ID | WP_001259011.1 |
| Coordinates | 4699596..4700042 (+) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QNM33_RS22915 (4694946) | 4694946..4695848 | + | 903 | WP_000331361.1 | formate dehydrogenase subunit beta | - |
| QNM33_RS22920 (4695845) | 4695845..4696480 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| QNM33_RS22925 (4696477) | 4696477..4697406 | + | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
| QNM33_RS22930 (4697453) | 4697453..4697743 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | - |
| QNM33_RS22935 (4697744) | 4697744..4698055 | - | 312 | WP_001159630.1 | cytotoxic translational repressor of toxin-antitoxin stability system | - |
| QNM33_RS22940 (4698273) | 4698273..4699202 | + | 930 | WP_001127703.1 | alpha/beta hydrolase | - |
| QNM33_RS22945 (4699288) | 4699288..4699599 | + | 312 | WP_000558166.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| QNM33_RS22950 (4699596) | 4699596..4700042 | + | 447 | WP_001259011.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
| QNM33_RS22955 (4700057) | 4700057..4700998 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| QNM33_RS22960 (4701043) | 4701043..4701480 | - | 438 | WP_000560974.1 | D-aminoacyl-tRNA deacylase | - |
| QNM33_RS22965 (4701477) | 4701477..4702349 | - | 873 | WP_000921427.1 | virulence factor BrkB family protein | - |
| QNM33_RS22970 (4702343) | 4702343..4702942 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
| QNM33_RS22975 (4703133) | 4703133..4703936 | - | 804 | WP_000059693.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| QNM33_RS22980 (4703970) | 4703970..4704866 | - | 897 | WP_001520529.1 | sugar kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12432.40 Da Isoelectric Point: 9.5334
>T282671 WP_000558166.1 NZ_CP126138:4699288-4699599 [Salmonella enterica subsp. enterica serovar Kottbus]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16734.08 Da Isoelectric Point: 6.6451
>AT282671 WP_001259011.1 NZ_CP126138:4699596-4700042 [Salmonella enterica subsp. enterica serovar Kottbus]
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|