Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 1237152..1237830 | Replicon | chromosome |
| Accession | NZ_CP125781 | ||
| Organism | Trabulsiella odontotermitis strain TBY01 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | - |
| Locus tag | QMG90_RS06015 | Protein ID | WP_080781780.1 |
| Coordinates | 1237152..1237475 (-) | Length | 108 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | QMG90_RS06020 | Protein ID | WP_080781779.1 |
| Coordinates | 1237507..1237830 (-) | Length | 108 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QMG90_RS06005 (QMG90_06005) | 1232688..1232984 | - | 297 | Protein_1178 | IS3 family transposase | - |
| QMG90_RS06010 (QMG90_06010) | 1233257..1236130 | - | 2874 | WP_283283010.1 | autotransporter outer membrane beta-barrel domain-containing protein | - |
| QMG90_RS06015 (QMG90_06015) | 1237152..1237475 | - | 324 | WP_080781780.1 | TA system toxin CbtA family protein | Toxin |
| QMG90_RS06020 (QMG90_06020) | 1237507..1237830 | - | 324 | WP_080781779.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QMG90_RS06025 (QMG90_06025) | 1237852..1238073 | - | 222 | WP_080781778.1 | DUF987 domain-containing protein | - |
| QMG90_RS06030 (QMG90_06030) | 1238082..1238552 | - | 471 | WP_032642914.1 | DNA repair protein RadC | - |
| QMG90_RS06035 (QMG90_06035) | 1238585..1239403 | - | 819 | WP_080781777.1 | DUF932 domain-containing protein | - |
| QMG90_RS06040 (QMG90_06040) | 1239749..1240660 | + | 912 | WP_080781776.1 | restriction endonuclease | - |
| QMG90_RS06045 (QMG90_06045) | 1240893..1241873 | + | 981 | WP_117308960.1 | IS5-like element ISKpn26 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 1231639..1232619 | 980 | |
| - | flank | IS/Tn | - | - | 1240893..1241873 | 980 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 108 a.a. Molecular weight: 12047.85 Da Isoelectric Point: 6.4783
>T282388 WP_080781780.1 NZ_CP125781:c1237475-1237152 [Trabulsiella odontotermitis]
MQISSVPATVPVSSRLSPVMVWQQLLTYLLEHHYGLTLNDTPFHDDTAIQGHIEAGITLADAVNFLVEKYELVRIDRKGF
SWQEQTPFITATDILRAKKSIGLLPRS
MQISSVPATVPVSSRLSPVMVWQQLLTYLLEHHYGLTLNDTPFHDDTAIQGHIEAGITLADAVNFLVEKYELVRIDRKGF
SWQEQTPFITATDILRAKKSIGLLPRS
Download Length: 324 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|