Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 948003..948660 | Replicon | chromosome |
| Accession | NZ_CP125781 | ||
| Organism | Trabulsiella odontotermitis strain TBY01 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | - |
| Locus tag | QMG90_RS04690 | Protein ID | WP_283282799.1 |
| Coordinates | 948250..948660 (+) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | - |
| Locus tag | QMG90_RS04685 | Protein ID | WP_054177491.1 |
| Coordinates | 948003..948269 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QMG90_RS04675 (QMG90_04675) | 946049..946714 | + | 666 | WP_283282797.1 | hemolysin III family protein | - |
| QMG90_RS04680 (QMG90_04680) | 946776..947756 | - | 981 | WP_283282798.1 | tRNA-modifying protein YgfZ | - |
| QMG90_RS04685 (QMG90_04685) | 948003..948269 | + | 267 | WP_054177491.1 | FAD assembly factor SdhE | Antitoxin |
| QMG90_RS04690 (QMG90_04690) | 948250..948660 | + | 411 | WP_283282799.1 | protein YgfX | Toxin |
| QMG90_RS04695 (QMG90_04695) | 948670..949191 | - | 522 | WP_283282800.1 | flavodoxin FldB | - |
| QMG90_RS04700 (QMG90_04700) | 949293..950189 | + | 897 | WP_283282801.1 | site-specific tyrosine recombinase XerD | - |
| QMG90_RS04705 (QMG90_04705) | 950212..950925 | + | 714 | WP_283282802.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| QMG90_RS04710 (QMG90_04710) | 950931..952664 | + | 1734 | WP_283282803.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16188.10 Da Isoelectric Point: 12.0920
>T282387 WP_283282799.1 NZ_CP125781:948250-948660 [Trabulsiella odontotermitis]
VVLWQSDLRVSWRSQWISLLLHGVVAAVVLLMPWPLSYTPLWLLLLSLVVFDSVRSQRRINARQGEIKLLMDGRLRWQNQ
EWEILGTPWMLSIGMLLRLRRVGQRRGQHLWLAADSMDSREWRDLRRVILQRPAQE
VVLWQSDLRVSWRSQWISLLLHGVVAAVVLLMPWPLSYTPLWLLLLSLVVFDSVRSQRRINARQGEIKLLMDGRLRWQNQ
EWEILGTPWMLSIGMLLRLRRVGQRRGQHLWLAADSMDSREWRDLRRVILQRPAQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|