Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/Tad-HTH_37 |
| Location | 3888215..3888812 | Replicon | chromosome |
| Accession | NZ_CP125734 | ||
| Organism | Klebsiella pneumoniae strain GYB02 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A9J6S5A1 |
| Locus tag | QMW18_RS18910 | Protein ID | WP_004893639.1 |
| Coordinates | 3888495..3888812 (-) | Length | 106 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | R4YH91 |
| Locus tag | QMW18_RS18905 | Protein ID | WP_004142561.1 |
| Coordinates | 3888215..3888502 (-) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QMW18_RS18875 (QMW18_18875) | 3884295..3884543 | + | 249 | WP_002893037.1 | DUF1158 domain-containing protein | - |
| QMW18_RS18880 (QMW18_18880) | 3884561..3884902 | - | 342 | WP_002893035.1 | RamA family antibiotic efflux transcriptional regulator | - |
| QMW18_RS18885 (QMW18_18885) | 3884933..3886048 | - | 1116 | WP_012737592.1 | MBL fold metallo-hydrolase | - |
| QMW18_RS18890 (QMW18_18890) | 3886228..3886809 | + | 582 | WP_004176968.1 | TetR/AcrR family transcriptional regulator | - |
| QMW18_RS18895 (QMW18_18895) | 3886809..3887177 | + | 369 | WP_004142557.1 | MmcQ/YjbR family DNA-binding protein | - |
| QMW18_RS18900 (QMW18_18900) | 3887297..3887950 | + | 654 | WP_004178896.1 | oxygen-insensitive NAD(P)H nitroreductase | - |
| QMW18_RS18905 (QMW18_18905) | 3888215..3888502 | - | 288 | WP_004142561.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| QMW18_RS18910 (QMW18_18910) | 3888495..3888812 | - | 318 | WP_004893639.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QMW18_RS18915 (QMW18_18915) | 3888997..3890040 | - | 1044 | WP_004893645.1 | DUF2157 domain-containing protein | - |
| QMW18_RS18920 (QMW18_18920) | 3890706..3891572 | - | 867 | WP_004151823.1 | helix-turn-helix transcriptional regulator | - |
| QMW18_RS18925 (QMW18_18925) | 3891681..3893108 | + | 1428 | WP_004176980.1 | MFS transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12100.35 Da Isoelectric Point: 11.2767
>T282326 WP_004893639.1 NZ_CP125734:c3888812-3888495 [Klebsiella pneumoniae]
MFRLVVHVDVKKELQALPSIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
MFRLVVHVDVKKELQALPSIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|