Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RelE-Phd |
| Location | 3160419..3160967 | Replicon | chromosome |
| Accession | NZ_CP125620 | ||
| Organism | Mycobacterium tuberculosis strain BLR 4299 2019 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | G0TFG5 |
| Locus tag | O3Q54_RS15085 | Protein ID | WP_003414602.1 |
| Coordinates | 3160704..3160967 (+) | Length | 88 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | O33347 |
| Locus tag | O3Q54_RS15080 | Protein ID | WP_003414599.1 |
| Coordinates | 3160419..3160700 (+) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O3Q54_RS15055 (O3Q54_15055) | 3156042..3156899 | - | 858 | WP_003899513.1 | type I methionyl aminopeptidase | - |
| O3Q54_RS15060 (O3Q54_15060) | 3156941..3157525 | - | 585 | WP_003899514.1 | DUF1707 domain-containing protein | - |
| O3Q54_RS15065 (O3Q54_15065) | 3157629..3157877 | + | 249 | WP_003913411.1 | antitoxin VapB23 | - |
| O3Q54_RS15070 (O3Q54_15070) | 3157874..3158254 | + | 381 | WP_003414592.1 | type II toxin-antitoxin system VapC family toxin | - |
| O3Q54_RS15075 (O3Q54_15075) | 3158336..3160147 | - | 1812 | WP_003906921.1 | penicillin-binding protein | - |
| O3Q54_RS15080 (O3Q54_15080) | 3160419..3160700 | + | 282 | WP_003414599.1 | type II toxin-antitoxin system antitoxin RelF | Antitoxin |
| O3Q54_RS15085 (O3Q54_15085) | 3160704..3160967 | + | 264 | WP_003414602.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| O3Q54_RS15090 (O3Q54_15090) | 3161340..3162194 | - | 855 | WP_003899516.1 | GNAT family N-acetyltransferase | - |
| O3Q54_RS15095 (O3Q54_15095) | 3162250..3163413 | - | 1164 | WP_003899517.1 | flavodoxin-dependent (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase | - |
| O3Q54_RS15100 (O3Q54_15100) | 3163430..3164644 | - | 1215 | WP_003899518.1 | zinc metalloprotease Rip | - |
| O3Q54_RS15105 (O3Q54_15105) | 3164652..3165893 | - | 1242 | WP_003414613.1 | 1-deoxy-D-xylulose-5-phosphate reductoisomerase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 88 a.a. Molecular weight: 10204.82 Da Isoelectric Point: 11.5078
>T282215 WP_003414602.1 NZ_CP125620:3160704-3160967 [Mycobacterium tuberculosis]
VPYTVRFTTTARRDLHKLPPRILAAVVEFAFGDLSREPLRVGKPLRRELAGTFSARRGTYRLLYRIDDEHTTVVILRVDH
RADIYRR
VPYTVRFTTTARRDLHKLPPRILAAVVEFAFGDLSREPLRVGKPLRRELAGTFSARRGTYRLLYRIDDEHTTVVILRVDH
RADIYRR
Download Length: 264 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 3G5O |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 3G5O | |
| AlphaFold DB | A0A7U4BWP8 |