Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-DnaT
Location 47573..48095 Replicon plasmid pYUXJMC1-2
Accession NZ_CP125352
Organism Escherichia fergusonii strain XJ19MCE1

Toxin (Protein)


Gene name relE Uniprot ID G3CAN5
Locus tag QKW25_RS24270 Protein ID WP_000220560.1
Coordinates 47814..48095 (+) Length 94 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID G3CAG1
Locus tag QKW25_RS24265 Protein ID WP_000121743.1
Coordinates 47573..47824 (+) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QKW25_RS24240 43244..43525 + 282 WP_001185482.1 hypothetical protein -
QKW25_RS24245 43550..44527 + 978 WP_024245156.1 hypothetical protein -
QKW25_RS24250 44524..44880 - 357 WP_000456533.1 DNA distortion polypeptide 3 -
QKW25_RS24255 45017..45463 - 447 Protein_49 hypothetical protein -
QKW25_RS24260 45503..46339 - 837 WP_001050931.1 RepB family plasmid replication initiator protein -
QKW25_RS24265 47573..47824 + 252 WP_000121743.1 plasmid stabilization protein Antitoxin
QKW25_RS24270 47814..48095 + 282 WP_000220560.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QKW25_RS24275 48170..48867 + 698 WP_103215986.1 IS1-like element IS1A family transposase -
QKW25_RS24280 48877..49185 + 309 Protein_54 replication initiation protein -
QKW25_RS24285 49278..49982 - 705 WP_001067858.1 IS6-like element IS26 family transposase -
QKW25_RS24290 50055..50279 + 225 WP_000743213.1 hypothetical protein -
QKW25_RS24295 50490..51983 + 1494 WP_015344975.1 IS91-like element ISVsa3 family transposase -
QKW25_RS24300 52014..52898 + 885 WP_001447541.1 DUF3363 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid tet(A) / dfrA12 / aadA2 / cmlA1 / ant(3'')-Ia / tet(M) / floR / blaTEM-1B - 1..82020 82020


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-86)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 11005.83 Da        Isoelectric Point: 10.5938

>T282111 WP_000220560.1 NZ_CP125352:47814-48095 [Escherichia fergusonii]
MTYELAFDRRALKEWQKLGHTIREQFKKKLAERLENPRVPAARLHGHADRYKIKLRASGYRLVYQVIDEKVVLLVIAVGR
RESSEVYQIADLR

Download         Length: 282 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9194.43 Da        Isoelectric Point: 4.1683

>AT282111 WP_000121743.1 NZ_CP125352:47573-47824 [Escherichia fergusonii]
MSYQILTTTAASITDLKKNPMGTVAEGEGDAVAILNRNEPAFYCVPPKLYAYYRELAEDAELNAVADERMKNPEIVKVNL
DDL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G3CAN5

Antitoxin

Source ID Structure
AlphaFold DB A0A3S5I301

References