Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 29681..30324 | Replicon | plasmid unnamed1 |
Accession | NZ_CP124805 | ||
Organism | Klebsiella variicola strain J57 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | D8L2J9 |
Locus tag | QLG20_RS27305 | Protein ID | WP_001044770.1 |
Coordinates | 29908..30324 (+) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | D5KTK7 |
Locus tag | QLG20_RS27300 | Protein ID | WP_001261282.1 |
Coordinates | 29681..29911 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QLG20_RS27280 (QLG20_27270) | 25746..27119 | + | 1374 | WP_282676415.1 | hypothetical protein | - |
QLG20_RS27285 (QLG20_27275) | 27304..28632 | + | 1329 | WP_004206607.1 | nucleotidyltransferase | - |
QLG20_RS27290 (QLG20_27280) | 28640..29215 | + | 576 | WP_004206608.1 | SLATT domain-containing protein | - |
QLG20_RS27295 (QLG20_27285) | 29482..29724 | - | 243 | Protein_33 | hypothetical protein | - |
QLG20_RS27300 (QLG20_27290) | 29681..29911 | + | 231 | WP_001261282.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
QLG20_RS27305 (QLG20_27295) | 29908..30324 | + | 417 | WP_001044770.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QLG20_RS27310 (QLG20_27300) | 30398..31960 | + | 1563 | WP_282676416.1 | AAA family ATPase | - |
QLG20_RS27315 (QLG20_27305) | 31945..32967 | + | 1023 | WP_000361404.1 | helicase UvrD | - |
QLG20_RS27320 (QLG20_27310) | 33511..34419 | + | 909 | WP_032426221.1 | HNH endonuclease | - |
QLG20_RS27325 (QLG20_27315) | 34605..34955 | - | 351 | WP_004187110.1 | DUF305 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | - | - | 1..174299 | 174299 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15106.52 Da Isoelectric Point: 7.1084
>T281237 WP_001044770.1 NZ_CP124805:29908-30324 [Klebsiella variicola]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GYM2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GZG3 |