Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 550896..551549 | Replicon | chromosome |
| Accession | NZ_CP124750 | ||
| Organism | Serratia sp. K-M0706 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | SSARUM_RS02525 | Protein ID | WP_060430834.1 |
| Coordinates | 550896..551246 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A5C7DBM3 |
| Locus tag | SSARUM_RS02530 | Protein ID | WP_019453270.1 |
| Coordinates | 551250..551549 (+) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SSARUM_RS02495 (SSARUM_000499) | 546161..546850 | - | 690 | WP_060430826.1 | trehalose-6-phosphate synthase | - |
| SSARUM_RS02500 (SSARUM_000500) | 546863..547273 | - | 411 | WP_060430828.1 | GNAT family N-acetyltransferase | - |
| SSARUM_RS02505 (SSARUM_000501) | 547302..548672 | - | 1371 | WP_041037742.1 | glutamine synthetase family protein | - |
| SSARUM_RS02510 (SSARUM_000502) | 548918..549235 | + | 318 | WP_041037744.1 | hypothetical protein | - |
| SSARUM_RS02515 (SSARUM_000503) | 549226..549621 | - | 396 | WP_060430830.1 | hypothetical protein | - |
| SSARUM_RS02520 (SSARUM_000504) | 549621..550625 | - | 1005 | WP_060430832.1 | hypothetical protein | - |
| SSARUM_RS02525 (SSARUM_000505) | 550896..551246 | + | 351 | WP_060430834.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| SSARUM_RS02530 (SSARUM_000506) | 551250..551549 | + | 300 | WP_019453270.1 | XRE family transcriptional regulator | Antitoxin |
| SSARUM_RS02535 (SSARUM_000507) | 551539..552456 | - | 918 | WP_060430836.1 | LysR family transcriptional regulator | - |
| SSARUM_RS02540 (SSARUM_000508) | 552625..553323 | + | 699 | WP_060430838.1 | CoA transferase subunit A | - |
| SSARUM_RS02545 (SSARUM_000509) | 553335..553988 | + | 654 | WP_060430840.1 | CoA transferase subunit B | - |
| SSARUM_RS02550 (SSARUM_000510) | 554002..555186 | + | 1185 | WP_060430842.1 | acetyl-CoA C-acetyltransferase | - |
| SSARUM_RS02555 (SSARUM_000511) | 555205..556128 | + | 924 | WP_039567560.1 | 3-hydroxyacyl-CoA dehydrogenase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13526.73 Da Isoelectric Point: 8.2699
>T281189 WP_060430834.1 NZ_CP124750:550896-551246 [Serratia sp. K-M0706]
MWTVMTTEEFDRWLCEQDESTQEKVLAALVMLERAGPSLRRPFVDVLKGSLHSNMKELRIQHKGRPIRAFFAFDPARQAI
VLCAGDKTGNEKRFYKVMLSIADAQFTQYLMCYFKE
MWTVMTTEEFDRWLCEQDESTQEKVLAALVMLERAGPSLRRPFVDVLKGSLHSNMKELRIQHKGRPIRAFFAFDPARQAI
VLCAGDKTGNEKRFYKVMLSIADAQFTQYLMCYFKE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|