Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
| Location | 5860774..5861369 | Replicon | chromosome |
| Accession | NZ_CP124600 | ||
| Organism | Pseudomonas aeruginosa strain Li010 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | V6ALY3 |
| Locus tag | QIU11_RS27890 | Protein ID | WP_003113526.1 |
| Coordinates | 5861091..5861369 (-) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | QIU11_RS27885 | Protein ID | WP_003113527.1 |
| Coordinates | 5860774..5861079 (-) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QIU11_RS27860 (QIU11_27860) | 5855786..5856058 | - | 273 | WP_003115921.1 | hypothetical protein | - |
| QIU11_RS27865 (QIU11_27865) | 5856833..5858719 | + | 1887 | WP_071567561.1 | ATP-binding protein | - |
| QIU11_RS27870 (QIU11_27870) | 5858898..5859170 | + | 273 | WP_071550096.1 | DNA-binding protein | - |
| QIU11_RS27875 (QIU11_27875) | 5859226..5859558 | + | 333 | WP_058177536.1 | hypothetical protein | - |
| QIU11_RS27880 (QIU11_27880) | 5859620..5860432 | + | 813 | WP_071550097.1 | hypothetical protein | - |
| QIU11_RS27885 (QIU11_27885) | 5860774..5861079 | - | 306 | WP_003113527.1 | HigA family addiction module antitoxin | Antitoxin |
| QIU11_RS27890 (QIU11_27890) | 5861091..5861369 | - | 279 | WP_003113526.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QIU11_RS27895 (QIU11_27895) | 5861422..5861550 | - | 129 | Protein_5513 | integrase | - |
| QIU11_RS27900 (QIU11_27900) | 5861698..5863926 | + | 2229 | WP_003099265.1 | TonB-dependent receptor | - |
| QIU11_RS27905 (QIU11_27905) | 5863996..5864643 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
| QIU11_RS27910 (QIU11_27910) | 5864705..5865943 | - | 1239 | WP_023084819.1 | C69 family dipeptidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10646.19 Da Isoelectric Point: 7.8937
>T280868 WP_003113526.1 NZ_CP124600:c5861369-5861091 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|