Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1985283..1986114 Replicon chromosome
Accession NZ_CP124506
Organism Escherichia coli strain AVS0750

Toxin (Protein)


Gene name yeeV Uniprot ID S1P968
Locus tag QJP88_RS09545 Protein ID WP_000854814.1
Coordinates 1985283..1985657 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A641DSP2
Locus tag QJP88_RS09550 Protein ID WP_001546021.1
Coordinates 1985746..1986114 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP88_RS09510 (1981278) 1981278..1981607 + 330 WP_000450409.1 DUF496 family protein -
QJP88_RS09515 (1981708) 1981708..1982031 - 324 WP_223216378.1 EutP/PduV family microcompartment system protein -
QJP88_RS09520 (1982010) 1982010..1982090 + 81 WP_023441679.1 hypothetical protein -
QJP88_RS09525 (1982301) 1982301..1983842 + 1542 WP_001298859.1 IS21-like element ISEc12 family transposase -
QJP88_RS09530 (1983857) 1983857..1984603 + 747 WP_001016257.1 IS21-like element ISEc12 family helper ATPase IstB -
QJP88_RS09535 (1984966) 1984966..1985046 - 81 Protein_1873 hypothetical protein -
QJP88_RS09540 (1985092) 1985092..1985286 - 195 WP_000988601.1 DUF5983 family protein -
QJP88_RS09545 (1985283) 1985283..1985657 - 375 WP_000854814.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
QJP88_RS09550 (1985746) 1985746..1986114 - 369 WP_001546021.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
QJP88_RS09555 (1986194) 1986194..1986415 - 222 WP_000692323.1 DUF987 domain-containing protein -
QJP88_RS09560 (1986478) 1986478..1986954 - 477 WP_001186773.1 RadC family protein -
QJP88_RS09565 (1986970) 1986970..1987443 - 474 WP_001385393.1 antirestriction protein -
QJP88_RS09570 (1987706) 1987706..1988527 - 822 WP_001234710.1 DUF932 domain-containing protein -
QJP88_RS09575 (1988748) 1988748..1989158 - 411 WP_000846704.1 hypothetical protein -
QJP88_RS09580 (1989174) 1989174..1989851 - 678 WP_001362823.1 hypothetical protein -
QJP88_RS09585 (1989987) 1989987..1991057 - 1071 WP_000102631.1 patatin-like phospholipase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13898.94 Da        Isoelectric Point: 7.8522

>T280676 WP_000854814.1 NZ_CP124506:c1985657-1985283 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13607.47 Da        Isoelectric Point: 6.3139

>AT280676 WP_001546021.1 NZ_CP124506:c1986114-1985746 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRASIRGLFSDADAYHPDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829FY50

Antitoxin

Source ID Structure
AlphaFold DB A0A641DSP2

References