Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 825203..826037 | Replicon | chromosome |
| Accession | NZ_CP124506 | ||
| Organism | Escherichia coli strain AVS0750 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | - |
| Locus tag | QJP88_RS04015 | Protein ID | WP_001546109.1 |
| Coordinates | 825203..825580 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A7I0L0C8 |
| Locus tag | QJP88_RS04020 | Protein ID | WP_001546108.1 |
| Coordinates | 825657..826037 (-) | Length | 127 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP88_RS03985 (821597) | 821597..821767 | - | 171 | Protein_783 | IS110 family transposase | - |
| QJP88_RS03990 (822184) | 822184..823118 | - | 935 | Protein_784 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
| QJP88_RS03995 (823111) | 823111..823506 | - | 396 | WP_000208383.1 | DUF6088 family protein | - |
| QJP88_RS04000 (823575) | 823575..824420 | - | 846 | WP_001280441.1 | DUF4942 domain-containing protein | - |
| QJP88_RS04005 (824505) | 824505..824702 | - | 198 | WP_000839260.1 | DUF957 domain-containing protein | - |
| QJP88_RS04010 (824719) | 824719..825206 | - | 488 | Protein_788 | DUF5983 family protein | - |
| QJP88_RS04015 (825203) | 825203..825580 | - | 378 | WP_001546109.1 | TA system toxin CbtA family protein | Toxin |
| QJP88_RS04020 (825657) | 825657..826037 | - | 381 | WP_001546108.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QJP88_RS04025 (826087) | 826087..826731 | - | 645 | WP_000086755.1 | hypothetical protein | - |
| QJP88_RS04030 (826750) | 826750..826971 | - | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| QJP88_RS04035 (827040) | 827040..827516 | - | 477 | WP_001424026.1 | RadC family protein | - |
| QJP88_RS04040 (827532) | 827532..828017 | - | 486 | WP_000849588.1 | antirestriction protein | - |
| QJP88_RS04045 (828072) | 828072..828890 | - | 819 | WP_001234620.1 | DUF932 domain-containing protein | - |
| QJP88_RS04050 (828990) | 828990..829223 | - | 234 | WP_001119729.1 | DUF905 family protein | - |
| QJP88_RS04055 (829302) | 829302..829757 | - | 456 | WP_001545736.1 | IrmA family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13986.00 Da Isoelectric Point: 8.5190
>T280673 WP_001546109.1 NZ_CP124506:c825580-825203 [Escherichia coli]
MKTLPDTHVRAASRCPSPVTIWQTLLTQLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYKMVNNITQGKHPEAKR
MKTLPDTHVRAASRCPSPVTIWQTLLTQLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYKMVNNITQGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 127 a.a. Molecular weight: 13997.78 Da Isoelectric Point: 5.0823
>AT280673 WP_001546108.1 NZ_CP124506:c826037-825657 [Escherichia coli]
MSDTLPGTTLPDDNKDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFNNADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCDADTLGSCGYVYLAVYPATETESNPPE
MSDTLPGTTLPDDNKDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFNNADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCDADTLGSCGYVYLAVYPATETESNPPE
Download Length: 381 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|