Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 4031958..4032508 Replicon chromosome
Accession NZ_CP124498
Organism Escherichia coli strain AVS0655

Toxin (Protein)


Gene name ccdB Uniprot ID S1PDG4
Locus tag QJP65_RS19725 Protein ID WP_001160966.1
Coordinates 4031958..4032272 (-) Length 105 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V0VEX8
Locus tag QJP65_RS19730 Protein ID WP_000125566.1
Coordinates 4032275..4032508 (-) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP65_RS19700 (4027633) 4027633..4028919 + 1287 WP_000800457.1 peptidylprolyl isomerase SurA -
QJP65_RS19705 (4028919) 4028919..4029908 + 990 WP_000241227.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
QJP65_RS19710 (4029905) 4029905..4030726 + 822 WP_001065363.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
QJP65_RS19715 (4030729) 4030729..4031106 + 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
QJP65_RS19720 (4031113) 4031113..4031961 + 849 WP_000257181.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
QJP65_RS19725 (4031958) 4031958..4032272 - 315 WP_001160966.1 CcdB family protein Toxin
QJP65_RS19730 (4032275) 4032275..4032508 - 234 WP_000125566.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
QJP65_RS19735 (4032594) 4032594..4033073 - 480 WP_000624375.1 type 3 dihydrofolate reductase -
QJP65_RS19740 (4033265) 4033265..4035127 - 1863 WP_000377124.1 glutathione-regulated potassium-efflux system protein KefC -
QJP65_RS19745 (4035120) 4035120..4035650 - 531 WP_000600725.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
QJP65_RS19750 (4035758) 4035758..4037089 - 1332 WP_001183207.1 MFS transporter -
QJP65_RS19755 (4037148) 4037148..4037435 - 288 WP_000203741.1 ferredoxin-like protein FixX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-103)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11711.72 Da        Isoelectric Point: 9.0851

>T280618 WP_001160966.1 NZ_CP124498:c4032272-4031958 [Escherichia coli]
MQFTVYRSRGRNAAFPFVIDVTSDIIGEINRRIVIPLTPIERFSRIRPPERLNPILLLVDGKEYVLMTHETATVPVNALG
TKFCDASAHRTLIKGALDFMLDGI

Download         Length: 315 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8530.53 Da        Isoelectric Point: 5.8062

>AT280618 WP_000125566.1 NZ_CP124498:c4032508-4032275 [Escherichia coli]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENAEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829G815

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LTM9

References