Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 822202..823036 | Replicon | chromosome |
| Accession | NZ_CP124492 | ||
| Organism | Escherichia coli strain AVS0225 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | - |
| Locus tag | QJA99_RS03990 | Protein ID | WP_138158058.1 |
| Coordinates | 822202..822579 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A7I0L0C8 |
| Locus tag | QJA99_RS03995 | Protein ID | WP_001546108.1 |
| Coordinates | 822656..823036 (-) | Length | 127 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJA99_RS03960 (818596) | 818596..818766 | - | 171 | Protein_778 | IS110 family transposase | - |
| QJA99_RS03965 (819183) | 819183..820117 | - | 935 | Protein_779 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
| QJA99_RS03970 (820110) | 820110..820505 | - | 396 | WP_000208383.1 | DUF6088 family protein | - |
| QJA99_RS03975 (820574) | 820574..821418 | - | 845 | Protein_781 | DUF4942 domain-containing protein | - |
| QJA99_RS03980 (821503) | 821503..821700 | - | 198 | WP_000839260.1 | DUF957 domain-containing protein | - |
| QJA99_RS03985 (821717) | 821717..822205 | - | 489 | WP_000761698.1 | DUF5983 family protein | - |
| QJA99_RS03990 (822202) | 822202..822579 | - | 378 | WP_138158058.1 | TA system toxin CbtA family protein | Toxin |
| QJA99_RS03995 (822656) | 822656..823036 | - | 381 | WP_001546108.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QJA99_RS04000 (823086) | 823086..823730 | - | 645 | WP_000086755.1 | hypothetical protein | - |
| QJA99_RS04005 (823749) | 823749..823970 | - | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| QJA99_RS04010 (824039) | 824039..824515 | - | 477 | WP_042962214.1 | RadC family protein | - |
| QJA99_RS04015 (824531) | 824531..825016 | - | 486 | WP_000849588.1 | antirestriction protein | - |
| QJA99_RS04020 (825071) | 825071..825889 | - | 819 | WP_001234620.1 | DUF932 domain-containing protein | - |
| QJA99_RS04025 (825989) | 825989..826222 | - | 234 | WP_001119729.1 | DUF905 family protein | - |
| QJA99_RS04030 (826301) | 826301..826756 | - | 456 | WP_001545736.1 | IrmA family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14026.07 Da Isoelectric Point: 8.5221
>T280559 WP_138158058.1 NZ_CP124492:c822579-822202 [Escherichia coli]
MKTLPDTHVRAASRCPSPVTIWQTLLTQLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRAIGLMTRNNYRMVNNITQGKHPEAKR
MKTLPDTHVRAASRCPSPVTIWQTLLTQLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRAIGLMTRNNYRMVNNITQGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 127 a.a. Molecular weight: 13997.78 Da Isoelectric Point: 5.0823
>AT280559 WP_001546108.1 NZ_CP124492:c823036-822656 [Escherichia coli]
MSDTLPGTTLPDDNKDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFNNADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCDADTLGSCGYVYLAVYPATETESNPPE
MSDTLPGTTLPDDNKDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFNNADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCDADTLGSCGYVYLAVYPATETESNPPE
Download Length: 381 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|