Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4089956..4090790 | Replicon | chromosome |
| Accession | NZ_CP124490 | ||
| Organism | Escherichia coli strain AVS0456 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A1J6XFW9 |
| Locus tag | QJP91_RS19840 | Protein ID | WP_000854770.1 |
| Coordinates | 4089956..4090333 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A1M1N885 |
| Locus tag | QJP91_RS19845 | Protein ID | WP_001280950.1 |
| Coordinates | 4090422..4090790 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP91_RS19815 (4086067) | 4086067..4087689 | - | 1623 | WP_001295726.1 | Alw26I/Eco31I/Esp3I family type II restriction adenine-specific DNA-methyltransferase | - |
| QJP91_RS19820 (4088351) | 4088351..4088656 | - | 306 | Protein_3891 | helix-turn-helix domain-containing protein | - |
| QJP91_RS19825 (4089023) | 4089023..4089172 | - | 150 | Protein_3892 | hypothetical protein | - |
| QJP91_RS19830 (4089278) | 4089278..4089454 | - | 177 | WP_000839286.1 | DUF957 domain-containing protein | - |
| QJP91_RS19835 (4089471) | 4089471..4089959 | - | 489 | WP_000761690.1 | DUF5983 family protein | - |
| QJP91_RS19840 (4089956) | 4089956..4090333 | - | 378 | WP_000854770.1 | TA system toxin CbtA family protein | Toxin |
| QJP91_RS19845 (4090422) | 4090422..4090790 | - | 369 | WP_001280950.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QJP91_RS19850 (4090953) | 4090953..4091174 | - | 222 | WP_001220314.1 | DUF987 domain-containing protein | - |
| QJP91_RS19855 (4091237) | 4091237..4091713 | - | 477 | WP_001186779.1 | RadC family protein | - |
| QJP91_RS19860 (4091729) | 4091729..4092193 | - | 465 | WP_000855061.1 | antirestriction protein | - |
| QJP91_RS19865 (4092535) | 4092535..4093353 | - | 819 | WP_001234712.1 | DUF932 domain-containing protein | - |
| QJP91_RS19870 (4093471) | 4093471..4093666 | - | 196 | Protein_3901 | DUF905 family protein | - |
| QJP91_RS19875 (4093737) | 4093737..4095638 | - | 1902 | Protein_3902 | Ag43/Cah family autotransporter adhesin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4077742..4118519 | 40777 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14196.37 Da Isoelectric Point: 8.7438
>T280554 WP_000854770.1 NZ_CP124490:c4090333-4089956 [Escherichia coli]
MKTLPDTHVRKVSRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
MKTLPDTHVRKVSRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13737.56 Da Isoelectric Point: 7.0268
>AT280554 WP_001280950.1 NZ_CP124490:c4090790-4090422 [Escherichia coli]
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAFYPTSETKK
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAFYPTSETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1J6XFW9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1M1N885 |