Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 822170..823004 Replicon chromosome
Accession NZ_CP124490
Organism Escherichia coli strain AVS0456

Toxin (Protein)


Gene name yeeV Uniprot ID S1PLF5
Locus tag QJP91_RS04000 Protein ID WP_000854690.1
Coordinates 822170..822547 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID S1P7N8
Locus tag QJP91_RS04005 Protein ID WP_001305076.1
Coordinates 822636..823004 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP91_RS03970 (818564) 818564..818734 - 171 Protein_781 IS110 family transposase -
QJP91_RS03975 (819151) 819151..820084 - 934 Protein_782 nucleotidyl transferase AbiEii/AbiGii toxin family protein -
QJP91_RS03980 (820077) 820077..820472 - 396 WP_000208384.1 DUF6088 family protein -
QJP91_RS03985 (820541) 820541..821386 - 846 WP_001529401.1 DUF4942 domain-containing protein -
QJP91_RS03990 (821471) 821471..821668 - 198 WP_000839293.1 DUF957 domain-containing protein -
QJP91_RS03995 (821685) 821685..822173 - 489 WP_000761699.1 DUF5983 family protein -
QJP91_RS04000 (822170) 822170..822547 - 378 WP_000854690.1 TA system toxin CbtA family protein Toxin
QJP91_RS04005 (822636) 822636..823004 - 369 WP_001305076.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
QJP91_RS04010 (823054) 823054..823698 - 645 WP_000094916.1 hypothetical protein -
QJP91_RS04015 (823717) 823717..823938 - 222 WP_000692329.1 DUF987 domain-containing protein -
QJP91_RS04020 (824001) 824001..824477 - 477 WP_001186726.1 RadC family protein -
QJP91_RS04025 (824493) 824493..824978 - 486 WP_000849565.1 antirestriction protein -
QJP91_RS04030 (825033) 825033..825851 - 819 WP_001234620.1 DUF932 domain-containing protein -
QJP91_RS04035 (825952) 825952..826185 - 234 WP_000902034.1 DUF905 family protein -
QJP91_RS04040 (826264) 826264..826719 - 456 WP_000581502.1 IrmA family protein -
QJP91_RS04045 (826795) 826795..827922 - 1128 Protein_796 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - ugd / kpsS / kpsC / kpsU / kpsD / kpsE / kpsF / sat 802620..872469 69849
- flank IS/Tn - - 818564..818719 155


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14057.04 Da        Isoelectric Point: 9.1510

>T280540 WP_000854690.1 NZ_CP124490:c822547-822170 [Escherichia coli]
MKTLPDTHVRAASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYAQVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13560.39 Da        Isoelectric Point: 4.7830

>AT280540 WP_001305076.1 NZ_CP124490:c823004-822636 [Escherichia coli]
MSDTLPGTTLPDDNKDLPWWGLPCTVTPCFGACLVQEGNRLHYLADRAGIRGRFSDADAYHPDQAFPLLMKQPELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCDYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1PLF5

Antitoxin

Source ID Structure
AlphaFold DB S1P7N8

References