Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4876658..4877492 | Replicon | chromosome |
| Accession | NZ_CP124455 | ||
| Organism | Escherichia coli strain AVS0193 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A4S3WCD6 |
| Locus tag | QJP76_RS23965 | Protein ID | WP_021566610.1 |
| Coordinates | 4877115..4877492 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | B3Y195 |
| Locus tag | QJP76_RS23960 | Protein ID | WP_001285585.1 |
| Coordinates | 4876658..4877026 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP76_RS23930 (4873563) | 4873563..4874017 | + | 455 | Protein_4687 | IrmA family protein | - |
| QJP76_RS23935 (4874096) | 4874096..4874329 | + | 234 | WP_001119729.1 | DUF905 family protein | - |
| QJP76_RS23940 (4874429) | 4874429..4875247 | + | 819 | WP_001234629.1 | DUF932 domain-containing protein | - |
| QJP76_RS23945 (4875329) | 4875329..4875808 | + | 480 | WP_048265132.1 | antirestriction protein | - |
| QJP76_RS23950 (4875824) | 4875824..4876300 | + | 477 | WP_001186726.1 | RadC family protein | - |
| QJP76_RS23955 (4876363) | 4876363..4876584 | + | 222 | WP_000692323.1 | DUF987 domain-containing protein | - |
| QJP76_RS23960 (4876658) | 4876658..4877026 | + | 369 | WP_001285585.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
| QJP76_RS23965 (4877115) | 4877115..4877492 | + | 378 | WP_021566610.1 | TA system toxin CbtA family protein | Toxin |
| QJP76_RS23970 (4877489) | 4877489..4877977 | + | 489 | WP_048237286.1 | DUF5983 family protein | - |
| QJP76_RS23975 (4877989) | 4877989..4878186 | + | 198 | WP_000839269.1 | DUF957 domain-containing protein | - |
| QJP76_RS23980 (4878271) | 4878271..4879116 | + | 846 | WP_021566612.1 | DUF4942 domain-containing protein | - |
| QJP76_RS23985 (4879709) | 4879709..4880206 | + | 498 | WP_000509815.1 | hypothetical protein | - |
| QJP76_RS23990 (4880384) | 4880384..4881307 | + | 924 | WP_000535950.1 | carboxylate/amino acid/amine transporter | - |
| QJP76_RS23995 (4881311) | 4881311..4882129 | - | 819 | WP_000779409.1 | lipoprotein NlpA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4864795..4880206 | 15411 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14058.02 Da Isoelectric Point: 7.8276
>T280335 WP_021566610.1 NZ_CP124455:4877115-4877492 [Escherichia coli]
MKTLPDTHVREASRCPSPVTIWQTLLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTHSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPGAKQ
MKTLPDTHVREASRCPSPVTIWQTLLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTHSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPGAKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13593.48 Da Isoelectric Point: 6.3139
>AT280335 WP_001285585.1 NZ_CP124455:4876658-4877026 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4S3WCD6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9LW60 |