Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 3916959..3917794 | Replicon | chromosome |
| Accession | NZ_CP124420 | ||
| Organism | Escherichia coli strain AVS0155 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A0J2AEA6 |
| Locus tag | QJP63_RS19165 | Protein ID | WP_000854759.1 |
| Coordinates | 3917417..3917794 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | S1NM52 |
| Locus tag | QJP63_RS19160 | Protein ID | WP_001295723.1 |
| Coordinates | 3916959..3917327 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP63_RS19135 (3914074) | 3914074..3914269 | + | 196 | Protein_3744 | DUF905 family protein | - |
| QJP63_RS19140 (3914387) | 3914387..3915205 | + | 819 | WP_001234738.1 | DUF932 domain-containing protein | - |
| QJP63_RS19145 (3915547) | 3915547..3916020 | + | 474 | WP_001350782.1 | antirestriction protein | - |
| QJP63_RS19150 (3916036) | 3916036..3916512 | + | 477 | WP_001186775.1 | RadC family protein | - |
| QJP63_RS19155 (3916575) | 3916575..3916796 | + | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| QJP63_RS19160 (3916959) | 3916959..3917327 | + | 369 | WP_001295723.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QJP63_RS19165 (3917417) | 3917417..3917794 | + | 378 | WP_000854759.1 | TA system toxin CbtA family protein | Toxin |
| QJP63_RS19170 (3917791) | 3917791..3918279 | + | 489 | WP_000761690.1 | DUF5983 family protein | - |
| QJP63_RS19175 (3918296) | 3918296..3918472 | + | 177 | WP_000839286.1 | DUF957 domain-containing protein | - |
| QJP63_RS19180 (3918578) | 3918578..3918727 | + | 150 | Protein_3753 | hypothetical protein | - |
| QJP63_RS19185 (3919094) | 3919094..3919399 | + | 306 | Protein_3754 | helix-turn-helix domain-containing protein | - |
| QJP63_RS19190 (3920061) | 3920061..3921683 | + | 1623 | WP_001295726.1 | Alw26I/Eco31I/Esp3I family type II restriction adenine-specific DNA-methyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 3903264..3930750 | 27486 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14144.26 Da Isoelectric Point: 7.3249
>T280166 WP_000854759.1 NZ_CP124420:3917417-3917794 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13592.40 Da Isoelectric Point: 6.6255
>AT280166 WP_001295723.1 NZ_CP124420:3916959-3917327 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J2AEA6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1NM52 |