Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 2354678..2355512 Replicon chromosome
Accession NZ_CP124420
Organism Escherichia coli strain AVS0155

Toxin (Protein)


Gene name yeeV Uniprot ID S1PLF5
Locus tag QJP63_RS11700 Protein ID WP_000854690.1
Coordinates 2355135..2355512 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID S1P7N8
Locus tag QJP63_RS11695 Protein ID WP_001305076.1
Coordinates 2354678..2355046 (+) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP63_RS11655 (2349760) 2349760..2350887 + 1128 Protein_2293 hypothetical protein -
QJP63_RS11660 (2350963) 2350963..2351418 + 456 WP_000581502.1 IrmA family protein -
QJP63_RS11665 (2351497) 2351497..2351730 + 234 WP_000902034.1 DUF905 family protein -
QJP63_RS11670 (2351831) 2351831..2352649 + 819 WP_001234620.1 DUF932 domain-containing protein -
QJP63_RS11675 (2352704) 2352704..2353189 + 486 WP_000849565.1 antirestriction protein -
QJP63_RS11680 (2353205) 2353205..2353681 + 477 WP_001186726.1 RadC family protein -
QJP63_RS11685 (2353744) 2353744..2353965 + 222 WP_000692329.1 DUF987 domain-containing protein -
QJP63_RS11690 (2353984) 2353984..2354628 + 645 WP_000094916.1 hypothetical protein -
QJP63_RS11695 (2354678) 2354678..2355046 + 369 WP_001305076.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
QJP63_RS11700 (2355135) 2355135..2355512 + 378 WP_000854690.1 TA system toxin CbtA family protein Toxin
QJP63_RS11705 (2355509) 2355509..2355997 + 489 WP_000761699.1 DUF5983 family protein -
QJP63_RS11710 (2356014) 2356014..2356211 + 198 WP_000839293.1 DUF957 domain-containing protein -
QJP63_RS11715 (2356296) 2356296..2357141 + 846 WP_001529401.1 DUF4942 domain-containing protein -
QJP63_RS11720 (2357210) 2357210..2357605 + 396 WP_000208384.1 DUF6088 family protein -
QJP63_RS11725 (2357598) 2357598..2358531 + 934 Protein_2307 nucleotidyl transferase AbiEii/AbiGii toxin family protein -
QJP63_RS11730 (2358948) 2358948..2359118 + 171 Protein_2308 IS110 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - kpsF / kpsE / kpsD / kpsU / kpsC / kpsS / ugd / kpsT 2310400..2376721 66321
- flank IS/Tn - - 2358963..2359118 155


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14057.04 Da        Isoelectric Point: 9.1510

>T280159 WP_000854690.1 NZ_CP124420:2355135-2355512 [Escherichia coli]
MKTLPDTHVRAASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYAQVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13560.39 Da        Isoelectric Point: 4.7830

>AT280159 WP_001305076.1 NZ_CP124420:2354678-2355046 [Escherichia coli]
MSDTLPGTTLPDDNKDLPWWGLPCTVTPCFGACLVQEGNRLHYLADRAGIRGRFSDADAYHPDQAFPLLMKQPELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCDYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1PLF5

Antitoxin

Source ID Structure
AlphaFold DB S1P7N8

References