Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1275951..1276782 Replicon chromosome
Accession NZ_CP124420
Organism Escherichia coli strain AVS0155

Toxin (Protein)


Gene name yeeV Uniprot ID A0A066T988
Locus tag QJP63_RS06720 Protein ID WP_000854815.1
Coordinates 1276408..1276782 (+) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A061Y7A8
Locus tag QJP63_RS06715 Protein ID WP_001280918.1
Coordinates 1275951..1276319 (+) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP63_RS06670 (1271040) 1271040..1271786 + 747 WP_001016257.1 IS21-like element ISEc12 family helper ATPase IstB -
QJP63_RS06675 (1271869) 1271869..1272219 + 351 Protein_1318 hypothetical protein -
QJP63_RS06680 (1272235) 1272235..1272645 + 411 WP_000846703.1 hypothetical protein -
QJP63_RS06685 (1272866) 1272866..1273684 + 819 WP_001542275.1 DUF932 domain-containing protein -
QJP63_RS06690 (1273684) 1273684..1273929 + 246 WP_001164966.1 hypothetical protein -
QJP63_RS06695 (1274023) 1274023..1274496 + 474 WP_001542276.1 antirestriction protein -
QJP63_RS06700 (1274512) 1274512..1274988 + 477 WP_001186200.1 RadC family protein -
QJP63_RS06705 (1275051) 1275051..1275272 + 222 WP_000692345.1 DUF987 domain-containing protein -
QJP63_RS06710 (1275291) 1275291..1275935 + 645 WP_000086752.1 hypothetical protein -
QJP63_RS06715 (1275951) 1275951..1276319 + 369 WP_001280918.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
QJP63_RS06720 (1276408) 1276408..1276782 + 375 WP_000854815.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
QJP63_RS06725 (1276779) 1276779..1276973 + 195 WP_000988600.1 DUF5983 family protein -
QJP63_RS06730 (1277019) 1277019..1277099 + 81 Protein_1329 hypothetical protein -
QJP63_RS06735 (1277388) 1277388..1277468 - 81 WP_023441679.1 hypothetical protein -
QJP63_RS06740 (1277447) 1277447..1277770 + 324 WP_225469267.1 EutP/PduV family microcompartment system protein -
QJP63_RS06745 (1277871) 1277871..1278200 - 330 WP_000450409.1 DUF496 family protein -
QJP63_RS06750 (1278372) 1278372..1279430 - 1059 WP_001200889.1 FUSC family protein -
QJP63_RS06755 (1279628) 1279628..1280101 - 474 WP_001105368.1 DNA gyrase inhibitor SbmC -
QJP63_RS06760 (1280220) 1280220..1281386 - 1167 WP_001296209.1 serine-type D-Ala-D-Ala carboxypeptidase DacD -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(19-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13829.83 Da        Isoelectric Point: 7.1326

>T280156 WP_000854815.1 NZ_CP124420:1276408-1276782 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTSDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13811.70 Da        Isoelectric Point: 6.4767

>AT280156 WP_001280918.1 NZ_CP124420:1275951-1276319 [Escherichia coli]
VSDKLHETNYPDDHNDRLWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A066T988

Antitoxin

Source ID Structure
AlphaFold DB A0A061Y7A8

References