Detailed information of TA system    

insolicoBioinformatically predicted

Overview


TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 422115..422336 Replicon chromosome
Accession NZ_CP124420
Organism Escherichia coli strain AVS0155

Toxin (Protein)


Gene name ldrD Uniprot ID A0A1U9U3P9
Locus tag QJP63_RS02285 Protein ID WP_001531632.1
Coordinates 422115..422222 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 422270..422336 (+)

Genomic Context


Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP63_RS02260 (417959) 417959..419041 + 1083 WP_000804726.1 peptide chain release factor 1 -
QJP63_RS02265 (419041) 419041..419874 + 834 WP_000456450.1 peptide chain release factor N(5)-glutamine methyltransferase -
QJP63_RS02270 (419871) 419871..420263 + 393 WP_000200375.1 invasion regulator SirB2 -
QJP63_RS02275 (420267) 420267..421076 + 810 WP_001257044.1 invasion regulator SirB1 -
QJP63_RS02280 (421112) 421112..421966 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
QJP63_RS02285 (422115) 422115..422222 - 108 WP_001531632.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (422272) 422272..422335 + 64 NuclAT_12 - -
- (422272) 422272..422335 + 64 NuclAT_12 - -
- (422272) 422272..422335 + 64 NuclAT_12 - -
- (422272) 422272..422335 + 64 NuclAT_12 - -
- (422272) 422272..422335 + 64 NuclAT_13 - -
- (422272) 422272..422335 + 64 NuclAT_13 - -
- (422272) 422272..422335 + 64 NuclAT_13 - -
- (422272) 422272..422335 + 64 NuclAT_13 - -
- (422272) 422272..422335 + 64 NuclAT_14 - -
- (422272) 422272..422335 + 64 NuclAT_14 - -
- (422272) 422272..422335 + 64 NuclAT_14 - -
- (422272) 422272..422335 + 64 NuclAT_14 - -
- (422272) 422272..422335 + 64 NuclAT_15 - -
- (422272) 422272..422335 + 64 NuclAT_15 - -
- (422272) 422272..422335 + 64 NuclAT_15 - -
- (422272) 422272..422335 + 64 NuclAT_15 - -
- (422272) 422272..422335 + 64 NuclAT_16 - -
- (422272) 422272..422335 + 64 NuclAT_16 - -
- (422272) 422272..422335 + 64 NuclAT_16 - -
- (422272) 422272..422335 + 64 NuclAT_16 - -
- (422272) 422272..422335 + 64 NuclAT_17 - -
- (422272) 422272..422335 + 64 NuclAT_17 - -
- (422272) 422272..422335 + 64 NuclAT_17 - -
- (422272) 422272..422335 + 64 NuclAT_17 - -
- (422270) 422270..422336 + 67 NuclAT_10 - Antitoxin
- (422270) 422270..422336 + 67 NuclAT_10 - Antitoxin
- (422270) 422270..422336 + 67 NuclAT_10 - Antitoxin
- (422270) 422270..422336 + 67 NuclAT_10 - Antitoxin
- (422270) 422270..422336 + 67 NuclAT_5 - Antitoxin
- (422270) 422270..422336 + 67 NuclAT_5 - Antitoxin
- (422270) 422270..422336 + 67 NuclAT_5 - Antitoxin
- (422270) 422270..422336 + 67 NuclAT_5 - Antitoxin
- (422270) 422270..422336 + 67 NuclAT_6 - Antitoxin
- (422270) 422270..422336 + 67 NuclAT_6 - Antitoxin
- (422270) 422270..422336 + 67 NuclAT_6 - Antitoxin
- (422270) 422270..422336 + 67 NuclAT_6 - Antitoxin
- (422270) 422270..422336 + 67 NuclAT_7 - Antitoxin
- (422270) 422270..422336 + 67 NuclAT_7 - Antitoxin
- (422270) 422270..422336 + 67 NuclAT_7 - Antitoxin
- (422270) 422270..422336 + 67 NuclAT_7 - Antitoxin
- (422270) 422270..422336 + 67 NuclAT_8 - Antitoxin
- (422270) 422270..422336 + 67 NuclAT_8 - Antitoxin
- (422270) 422270..422336 + 67 NuclAT_8 - Antitoxin
- (422270) 422270..422336 + 67 NuclAT_8 - Antitoxin
- (422270) 422270..422336 + 67 NuclAT_9 - Antitoxin
- (422270) 422270..422336 + 67 NuclAT_9 - Antitoxin
- (422270) 422270..422336 + 67 NuclAT_9 - Antitoxin
- (422270) 422270..422336 + 67 NuclAT_9 - Antitoxin
- (422272) 422272..422337 + 66 NuclAT_18 - -
- (422272) 422272..422337 + 66 NuclAT_18 - -
- (422272) 422272..422337 + 66 NuclAT_18 - -
- (422272) 422272..422337 + 66 NuclAT_18 - -
- (422272) 422272..422337 + 66 NuclAT_19 - -
- (422272) 422272..422337 + 66 NuclAT_19 - -
- (422272) 422272..422337 + 66 NuclAT_19 - -
- (422272) 422272..422337 + 66 NuclAT_19 - -
- (422272) 422272..422337 + 66 NuclAT_20 - -
- (422272) 422272..422337 + 66 NuclAT_20 - -
- (422272) 422272..422337 + 66 NuclAT_20 - -
- (422272) 422272..422337 + 66 NuclAT_20 - -
- (422272) 422272..422337 + 66 NuclAT_21 - -
- (422272) 422272..422337 + 66 NuclAT_21 - -
- (422272) 422272..422337 + 66 NuclAT_21 - -
- (422272) 422272..422337 + 66 NuclAT_21 - -
- (422272) 422272..422337 + 66 NuclAT_22 - -
- (422272) 422272..422337 + 66 NuclAT_22 - -
- (422272) 422272..422337 + 66 NuclAT_22 - -
- (422272) 422272..422337 + 66 NuclAT_22 - -
- (422272) 422272..422337 + 66 NuclAT_23 - -
- (422272) 422272..422337 + 66 NuclAT_23 - -
- (422272) 422272..422337 + 66 NuclAT_23 - -
- (422272) 422272..422337 + 66 NuclAT_23 - -
QJP63_RS02290 (422627) 422627..423727 - 1101 WP_000063608.1 sodium-potassium/proton antiporter ChaA -
QJP63_RS02295 (423997) 423997..424236 + 240 WP_000120702.1 putative cation transport regulator ChaB -
QJP63_RS02300 (424385) 424385..425080 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
QJP63_RS02305 (425124) 425124..425477 - 354 WP_001169659.1 DsrE/F sulfur relay family protein YchN -
QJP63_RS02310 (425662) 425662..427056 + 1395 WP_000086187.1 inverse autotransporter invasin YchO -

Associated MGEs


MGE
detail
Similar
MGEs
Relative
position
MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains


Predicted by InterproScan

Toxin

(1-35)


Sequences


Toxin        


Download         Length: 36 a.a.        Molecular weight: 4040.89 Da        Isoelectric Point: 12.5163

>T280147 WP_001531632.1 NZ_CP124420:c422222-422115 [Escherichia coli]
MTLAQFAMIFWHNLAAPILAGIITAVIVSWWRNRK

Download         Length: 108 bp


Antitoxin


Download         Length: 67 bp

>AT280147 NZ_CP124420:422270-422336 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures


Toxin

Source ID Structure
AlphaFold DB A0A1U9U3P9


Antitoxin

Download structure file

References