Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 53743..53982 | Replicon | plasmid pAVS0935-A |
| Accession | NZ_CP124406 | ||
| Organism | Escherichia coli strain AVS0935 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | A0A762TWR7 |
| Locus tag | QJB05_RS24225 | Protein ID | WP_023144756.1 |
| Coordinates | 53743..53877 (-) | Length | 45 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 53922..53982 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJB05_RS24185 (49090) | 49090..49505 | - | 416 | Protein_59 | IS1-like element IS1B family transposase | - |
| QJB05_RS24190 (49754) | 49754..50155 | - | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| QJB05_RS24195 (50088) | 50088..50345 | - | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| QJB05_RS24200 (50438) | 50438..51091 | - | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| QJB05_RS24205 (51189) | 51189..51329 | - | 141 | WP_001333237.1 | hypothetical protein | - |
| QJB05_RS24210 (52031) | 52031..52888 | - | 858 | WP_001617855.1 | incFII family plasmid replication initiator RepA | - |
| QJB05_RS24215 (52881) | 52881..52955 | - | 75 | WP_031943482.1 | RepA leader peptide Tap | - |
| QJB05_RS24220 (53192) | 53192..53446 | - | 255 | WP_000083850.1 | replication regulatory protein RepA | - |
| QJB05_RS24225 (53743) | 53743..53877 | - | 135 | WP_023144756.1 | Hok/Gef family protein | Toxin |
| - (53922) | 53922..53982 | + | 61 | NuclAT_0 | - | Antitoxin |
| - (53922) | 53922..53982 | + | 61 | NuclAT_0 | - | Antitoxin |
| - (53922) | 53922..53982 | + | 61 | NuclAT_0 | - | Antitoxin |
| - (53922) | 53922..53982 | + | 61 | NuclAT_0 | - | Antitoxin |
| QJB05_RS24230 (53949) | 53949..54235 | - | 287 | Protein_68 | DUF2726 domain-containing protein | - |
| QJB05_RS24235 (54313) | 54313..55926 | - | 1614 | WP_000080195.1 | IS66-like element ISEc23 family transposase | - |
| QJB05_RS24240 (55957) | 55957..56307 | - | 351 | WP_000624722.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| QJB05_RS24245 (56304) | 56304..56729 | - | 426 | WP_000422741.1 | transposase | - |
| QJB05_RS24255 (57738) | 57738..57986 | - | 249 | WP_001553845.1 | hypothetical protein | - |
| QJB05_RS24260 (58012) | 58012..58575 | - | 564 | WP_001348621.1 | class I SAM-dependent methyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | aadA5 / qacE / sul1 / mph(A) / sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / blaCTX-M-27 | - | 1..91501 | 91501 | |
| - | inside | IScluster/Tn | aadA5 / qacE / sul1 / mph(A) / sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / blaCTX-M-27 | - | 28169..57682 | 29513 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 45 a.a. Molecular weight: 4896.90 Da Isoelectric Point: 7.7209
>T280068 WP_023144756.1 NZ_CP124406:c53877-53743 [Escherichia coli]
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
Download Length: 135 bp
Antitoxin
Download Length: 61 bp
>AT280068 NZ_CP124406:53922-53982 [Escherichia coli]
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
