Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 2035025..2035859 Replicon chromosome
Accession NZ_CP124385
Organism Escherichia coli strain AVS0153

Toxin (Protein)


Gene name yeeV Uniprot ID S1PLF5
Locus tag QJP67_RS10185 Protein ID WP_000854690.1
Coordinates 2035482..2035859 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID S1P7N8
Locus tag QJP67_RS10180 Protein ID WP_001305076.1
Coordinates 2035025..2035393 (+) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP67_RS10140 (2030107) 2030107..2031234 + 1128 Protein_1994 hypothetical protein -
QJP67_RS10145 (2031310) 2031310..2031765 + 456 WP_000581502.1 IrmA family protein -
QJP67_RS10150 (2031844) 2031844..2032077 + 234 WP_000902034.1 DUF905 family protein -
QJP67_RS10155 (2032178) 2032178..2032996 + 819 WP_001234620.1 DUF932 domain-containing protein -
QJP67_RS10160 (2033051) 2033051..2033536 + 486 WP_000849565.1 antirestriction protein -
QJP67_RS10165 (2033552) 2033552..2034028 + 477 WP_001186726.1 RadC family protein -
QJP67_RS10170 (2034091) 2034091..2034312 + 222 WP_000692329.1 DUF987 domain-containing protein -
QJP67_RS10175 (2034331) 2034331..2034975 + 645 WP_000094916.1 hypothetical protein -
QJP67_RS10180 (2035025) 2035025..2035393 + 369 WP_001305076.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
QJP67_RS10185 (2035482) 2035482..2035859 + 378 WP_000854690.1 TA system toxin CbtA family protein Toxin
QJP67_RS10190 (2035856) 2035856..2036344 + 489 WP_000761699.1 DUF5983 family protein -
QJP67_RS10195 (2036361) 2036361..2036558 + 198 WP_000839293.1 DUF957 domain-containing protein -
QJP67_RS10200 (2036643) 2036643..2037488 + 846 WP_001529401.1 DUF4942 domain-containing protein -
QJP67_RS10205 (2037557) 2037557..2037952 + 396 WP_000208384.1 DUF6088 family protein -
QJP67_RS10210 (2037945) 2037945..2038878 + 934 Protein_2008 nucleotidyl transferase AbiEii/AbiGii toxin family protein -
QJP67_RS10215 (2039295) 2039295..2039465 + 171 Protein_2009 IS110 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14057.04 Da        Isoelectric Point: 9.1510

>T279956 WP_000854690.1 NZ_CP124385:2035482-2035859 [Escherichia coli]
MKTLPDTHVRAASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYAQVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13560.39 Da        Isoelectric Point: 4.7830

>AT279956 WP_001305076.1 NZ_CP124385:2035025-2035393 [Escherichia coli]
MSDTLPGTTLPDDNKDLPWWGLPCTVTPCFGACLVQEGNRLHYLADRAGIRGRFSDADAYHPDQAFPLLMKQPELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCDYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1PLF5

Antitoxin

Source ID Structure
AlphaFold DB S1P7N8

References