Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
Location | 3589460..3590055 | Replicon | chromosome |
Accession | NZ_CP124353 | ||
Organism | Escherichia coli strain AVS0226 |
Toxin (Protein)
Gene name | chpB | Uniprot ID | U9Y4M4 |
Locus tag | QJP71_RS17630 | Protein ID | WP_000239579.1 |
Coordinates | 3589705..3590055 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | chpS | Uniprot ID | U9Y2K1 |
Locus tag | QJP71_RS17625 | Protein ID | WP_001223208.1 |
Coordinates | 3589460..3589711 (+) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QJP71_RS17615 (3585125) | 3585125..3588904 | + | 3780 | WP_000060945.1 | autotransporter assembly complex protein TamB | - |
QJP71_RS17620 (3588907) | 3588907..3589248 | + | 342 | WP_001219160.1 | gamma-glutamylcyclotransferase | - |
QJP71_RS17625 (3589460) | 3589460..3589711 | + | 252 | WP_001223208.1 | type II toxin-antitoxin system antitoxin ChpS | Antitoxin |
QJP71_RS17630 (3589705) | 3589705..3590055 | + | 351 | WP_000239579.1 | endoribonuclease toxin ChpB | Toxin |
QJP71_RS17635 (3590135) | 3590135..3590665 | - | 531 | WP_000055075.1 | inorganic diphosphatase | - |
QJP71_RS17640 (3590975) | 3590975..3591931 | + | 957 | WP_000265933.1 | galactofuranose ABC transporter substrate-binding protein YtfQ | - |
QJP71_RS17645 (3592071) | 3592071..3593573 | + | 1503 | WP_000205813.1 | sugar ABC transporter ATP-binding protein | - |
QJP71_RS17650 (3593587) | 3593587..3594609 | + | 1023 | WP_001296689.1 | ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12511.45 Da Isoelectric Point: 5.6219
>T279750 WP_000239579.1 NZ_CP124353:3589705-3590055 [Escherichia coli]
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAADEVVEEALLRLQAVVE
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAADEVVEEALLRLQAVVE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0Y8A8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9LQ26 |