Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 866222..867053 Replicon chromosome
Accession NZ_CP124353
Organism Escherichia coli strain AVS0226

Toxin (Protein)


Gene name yeeV Uniprot ID A0A066T988
Locus tag QJP71_RS04580 Protein ID WP_000854815.1
Coordinates 866679..867053 (+) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A061Y7A8
Locus tag QJP71_RS04575 Protein ID WP_001280918.1
Coordinates 866222..866590 (+) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP71_RS04530 (861311) 861311..862057 + 747 WP_001016257.1 IS21-like element ISEc12 family helper ATPase IstB -
QJP71_RS04535 (862140) 862140..862490 + 351 Protein_895 hypothetical protein -
QJP71_RS04540 (862506) 862506..862916 + 411 WP_000846703.1 hypothetical protein -
QJP71_RS04545 (863137) 863137..863955 + 819 WP_001542275.1 DUF932 domain-containing protein -
QJP71_RS04550 (863955) 863955..864200 + 246 WP_001164966.1 hypothetical protein -
QJP71_RS04555 (864294) 864294..864767 + 474 WP_001542276.1 antirestriction protein -
QJP71_RS04560 (864783) 864783..865259 + 477 WP_001186200.1 RadC family protein -
QJP71_RS04565 (865322) 865322..865543 + 222 WP_000692345.1 DUF987 domain-containing protein -
QJP71_RS04570 (865562) 865562..866206 + 645 WP_000086752.1 hypothetical protein -
QJP71_RS04575 (866222) 866222..866590 + 369 WP_001280918.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
QJP71_RS04580 (866679) 866679..867053 + 375 WP_000854815.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
QJP71_RS04585 (867050) 867050..867244 + 195 WP_000988600.1 DUF5983 family protein -
QJP71_RS04590 (867290) 867290..867370 + 81 Protein_906 hypothetical protein -
QJP71_RS04595 (867659) 867659..867739 - 81 WP_023441679.1 hypothetical protein -
QJP71_RS04600 (867718) 867718..868041 + 324 WP_225469267.1 EutP/PduV family microcompartment system protein -
QJP71_RS04605 (868142) 868142..868471 - 330 WP_000450409.1 DUF496 family protein -
QJP71_RS04610 (868643) 868643..869701 - 1059 WP_001200889.1 FUSC family protein -
QJP71_RS04615 (869899) 869899..870372 - 474 WP_001105368.1 DNA gyrase inhibitor SbmC -
QJP71_RS04620 (870491) 870491..871657 - 1167 WP_001296209.1 serine-type D-Ala-D-Ala carboxypeptidase DacD -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 804683..914957 110274


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(19-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13829.83 Da        Isoelectric Point: 7.1326

>T279740 WP_000854815.1 NZ_CP124353:866679-867053 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTSDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13811.70 Da        Isoelectric Point: 6.4767

>AT279740 WP_001280918.1 NZ_CP124353:866222-866590 [Escherichia coli]
VSDKLHETNYPDDHNDRLWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A066T988

Antitoxin

Source ID Structure
AlphaFold DB A0A061Y7A8

References