Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 2088924..2089758 Replicon chromosome
Accession NZ_CP124334
Organism Escherichia coli strain AVS0786

Toxin (Protein)


Gene name yeeV Uniprot ID A0A1J6XFW9
Locus tag QJP89_RS10440 Protein ID WP_000854770.1
Coordinates 2088924..2089301 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A1M1N885
Locus tag QJP89_RS10445 Protein ID WP_001280950.1
Coordinates 2089390..2089758 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP89_RS10415 (2085035) 2085035..2086657 - 1623 WP_001295726.1 Alw26I/Eco31I/Esp3I family type II restriction adenine-specific DNA-methyltransferase -
QJP89_RS10420 (2087448) 2087448..2087624 - 177 Protein_2048 helix-turn-helix domain-containing protein -
QJP89_RS10425 (2087991) 2087991..2088140 - 150 Protein_2049 hypothetical protein -
QJP89_RS10430 (2088246) 2088246..2088422 - 177 WP_000839286.1 DUF957 domain-containing protein -
QJP89_RS10435 (2088439) 2088439..2088927 - 489 WP_000761690.1 DUF5983 family protein -
QJP89_RS10440 (2088924) 2088924..2089301 - 378 WP_000854770.1 TA system toxin CbtA family protein Toxin
QJP89_RS10445 (2089390) 2089390..2089758 - 369 WP_001280950.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
QJP89_RS10450 (2089921) 2089921..2090142 - 222 WP_001220314.1 DUF987 domain-containing protein -
QJP89_RS10455 (2090205) 2090205..2090681 - 477 WP_001186779.1 RadC family protein -
QJP89_RS10460 (2090697) 2090697..2091161 - 465 WP_000855061.1 antirestriction protein -
QJP89_RS10465 (2091503) 2091503..2092321 - 819 WP_001234712.1 DUF932 domain-containing protein -
QJP89_RS10470 (2092439) 2092439..2092634 - 196 Protein_2058 DUF905 family protein -
QJP89_RS10475 (2092809) 2092809..2093234 + 426 WP_000422741.1 transposase -
QJP89_RS10480 (2093231) 2093231..2093581 + 351 WP_000624722.1 IS66 family insertion sequence element accessory protein TnpB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 2077278..2120027 42749


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14196.37 Da        Isoelectric Point: 8.7438

>T279522 WP_000854770.1 NZ_CP124334:c2089301-2088924 [Escherichia coli]
MKTLPDTHVRKVSRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13737.56 Da        Isoelectric Point: 7.0268

>AT279522 WP_001280950.1 NZ_CP124334:c2089758-2089390 [Escherichia coli]
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAFYPTSETKK

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1J6XFW9

Antitoxin

Source ID Structure
AlphaFold DB A0A1M1N885

References