Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 3386463..3387264 Replicon chromosome
Accession NZ_CP124332
Organism Escherichia coli strain AVS0753

Toxin (Protein)


Gene name yeeV Uniprot ID D8EBK0
Locus tag QJP82_RS16630 Protein ID WP_001094436.1
Coordinates 3386463..3386840 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID B7MN76
Locus tag QJP82_RS16635 Protein ID WP_015953067.1
Coordinates 3386887..3387264 (-) Length 126 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP82_RS16600 (3382422) 3382422..3382583 - 162 Protein_3242 DUF4942 domain-containing protein -
QJP82_RS16605 (3382674) 3382674..3384173 + 1500 WP_029700729.1 IS21-like element ISEc10 family transposase -
QJP82_RS16610 (3384170) 3384170..3384925 + 756 WP_000065240.1 IS21-like element ISEc10 family helper ATPase IstB -
QJP82_RS16615 (3384974) 3384974..3385684 - 711 WP_001621817.1 DUF4942 domain-containing protein -
QJP82_RS16620 (3385769) 3385769..3385966 - 198 WP_000839254.1 DUF957 domain-containing protein -
QJP82_RS16625 (3385978) 3385978..3386466 - 489 WP_000761714.1 DUF5983 family protein -
QJP82_RS16630 (3386463) 3386463..3386840 - 378 WP_001094436.1 TA system toxin CbtA family protein Toxin
QJP82_RS16635 (3386887) 3386887..3387264 - 378 WP_015953067.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
QJP82_RS16640 (3387343) 3387343..3387564 - 222 WP_000692312.1 DUF987 domain-containing protein -
QJP82_RS16645 (3387633) 3387633..3388109 - 477 WP_001186756.1 RadC family protein -
QJP82_RS16650 (3388124) 3388124..3388609 - 486 WP_029700724.1 antirestriction protein -
QJP82_RS16655 (3388701) 3388701..3389519 - 819 WP_001175163.1 DUF932 domain-containing protein -
QJP82_RS16660 (3389609) 3389609..3389842 - 234 WP_001278287.1 DUF905 family protein -
QJP82_RS16665 (3389848) 3389848..3390525 - 678 WP_001097301.1 hypothetical protein -
QJP82_RS16670 (3390673) 3390673..3391353 - 681 WP_001282919.1 WYL domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 13958.84 Da        Isoelectric Point: 6.8603

>T279491 WP_001094436.1 NZ_CP124332:c3386840-3386463 [Escherichia coli]
MNTLPDTHVREASGCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 126 a.a.        Molecular weight: 13766.60 Da        Isoelectric Point: 6.2021

>AT279491 WP_015953067.1 NZ_CP124332:c3387264-3386887 [Escherichia coli]
VSDTLPGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTITLYAKGLTCEADTLGSCGYVYLAVYPTPAAPAITV

Download         Length: 378 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E2L1N0

Antitoxin

Source ID Structure
AlphaFold DB A0A5Z3CIS0

References