Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 4035709..4036543 Replicon chromosome
Accession NZ_CP124328
Organism Escherichia coli strain AVS0787

Toxin (Protein)


Gene name yeeV Uniprot ID S1PLF5
Locus tag QJP62_RS20040 Protein ID WP_000854690.1
Coordinates 4035709..4036086 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID S1P7N8
Locus tag QJP62_RS20045 Protein ID WP_001305076.1
Coordinates 4036175..4036543 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP62_RS20010 (4032103) 4032103..4032273 - 171 Protein_3919 IS110 family transposase -
QJP62_RS20015 (4032690) 4032690..4033623 - 934 Protein_3920 nucleotidyl transferase AbiEii/AbiGii toxin family protein -
QJP62_RS20020 (4033616) 4033616..4034011 - 396 WP_000208384.1 DUF6088 family protein -
QJP62_RS20025 (4034080) 4034080..4034925 - 846 WP_001529401.1 DUF4942 domain-containing protein -
QJP62_RS20030 (4035010) 4035010..4035207 - 198 WP_000839293.1 DUF957 domain-containing protein -
QJP62_RS20035 (4035224) 4035224..4035712 - 489 WP_000761699.1 DUF5983 family protein -
QJP62_RS20040 (4035709) 4035709..4036086 - 378 WP_000854690.1 TA system toxin CbtA family protein Toxin
QJP62_RS20045 (4036175) 4036175..4036543 - 369 WP_001305076.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
QJP62_RS20050 (4036593) 4036593..4037237 - 645 WP_000094916.1 hypothetical protein -
QJP62_RS20055 (4037256) 4037256..4037477 - 222 WP_000692329.1 DUF987 domain-containing protein -
QJP62_RS20060 (4037540) 4037540..4038016 - 477 WP_001186726.1 RadC family protein -
QJP62_RS20065 (4038032) 4038032..4038517 - 486 WP_000849565.1 antirestriction protein -
QJP62_RS20070 (4038572) 4038572..4039390 - 819 WP_001234620.1 DUF932 domain-containing protein -
QJP62_RS20075 (4039491) 4039491..4039724 - 234 WP_000902034.1 DUF905 family protein -
QJP62_RS20080 (4039803) 4039803..4040258 - 456 WP_000581502.1 IrmA family protein -
QJP62_RS20085 (4040334) 4040334..4041461 - 1128 Protein_3934 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - kpsM / kpsT / kpsS / kpsC / kpsU / kpsD / kpsE / kpsF 4014092..4038517 24425
- flank IS/Tn - - 4032103..4032258 155


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14057.04 Da        Isoelectric Point: 9.1510

>T279457 WP_000854690.1 NZ_CP124328:c4036086-4035709 [Escherichia coli]
MKTLPDTHVRAASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYAQVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13560.39 Da        Isoelectric Point: 4.7830

>AT279457 WP_001305076.1 NZ_CP124328:c4036543-4036175 [Escherichia coli]
MSDTLPGTTLPDDNKDLPWWGLPCTVTPCFGACLVQEGNRLHYLADRAGIRGRFSDADAYHPDQAFPLLMKQPELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCDYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1PLF5

Antitoxin

Source ID Structure
AlphaFold DB S1P7N8

References