Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 2684665..2685466 Replicon chromosome
Accession NZ_CP124328
Organism Escherichia coli strain AVS0787

Toxin (Protein)


Gene name yeeV Uniprot ID D8EBK0
Locus tag QJP62_RS13615 Protein ID WP_001094436.1
Coordinates 2685089..2685466 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID B7MN76
Locus tag QJP62_RS13610 Protein ID WP_015953067.1
Coordinates 2684665..2685042 (+) Length 126 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP62_RS13575 (2680576) 2680576..2681256 + 681 WP_001282919.1 WYL domain-containing protein -
QJP62_RS13580 (2681404) 2681404..2682081 + 678 WP_001097301.1 hypothetical protein -
QJP62_RS13585 (2682087) 2682087..2682320 + 234 WP_001278287.1 DUF905 family protein -
QJP62_RS13590 (2682410) 2682410..2683228 + 819 WP_001175163.1 DUF932 domain-containing protein -
QJP62_RS13595 (2683320) 2683320..2683805 + 486 WP_029700724.1 antirestriction protein -
QJP62_RS13600 (2683820) 2683820..2684296 + 477 WP_001186756.1 RadC family protein -
QJP62_RS13605 (2684365) 2684365..2684586 + 222 WP_000692312.1 DUF987 domain-containing protein -
QJP62_RS13610 (2684665) 2684665..2685042 + 378 WP_015953067.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
QJP62_RS13615 (2685089) 2685089..2685466 + 378 WP_001094436.1 TA system toxin CbtA family protein Toxin
QJP62_RS13620 (2685463) 2685463..2685951 + 489 WP_000761714.1 DUF5983 family protein -
QJP62_RS13625 (2685963) 2685963..2686160 + 198 WP_000839254.1 DUF957 domain-containing protein -
QJP62_RS13630 (2686245) 2686245..2686955 + 711 WP_001621817.1 DUF4942 domain-containing protein -
QJP62_RS13635 (2687004) 2687004..2687759 - 756 WP_000065240.1 IS21-like element ISEc10 family helper ATPase IstB -
QJP62_RS13640 (2687756) 2687756..2689255 - 1500 WP_029700729.1 IS21-like element ISEc10 family transposase -
QJP62_RS13645 (2689346) 2689346..2689507 + 162 Protein_2686 DUF4942 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 13958.84 Da        Isoelectric Point: 6.8603

>T279451 WP_001094436.1 NZ_CP124328:2685089-2685466 [Escherichia coli]
MNTLPDTHVREASGCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 126 a.a.        Molecular weight: 13766.60 Da        Isoelectric Point: 6.2021

>AT279451 WP_015953067.1 NZ_CP124328:2684665-2685042 [Escherichia coli]
VSDTLPGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTITLYAKGLTCEADTLGSCGYVYLAVYPTPAAPAITV

Download         Length: 378 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E2L1N0

Antitoxin

Source ID Structure
AlphaFold DB A0A5Z3CIS0

References