Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 2384471..2385306 | Replicon | chromosome |
| Accession | NZ_CP124328 | ||
| Organism | Escherichia coli strain AVS0787 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A0J2AEA6 |
| Locus tag | QJP62_RS12095 | Protein ID | WP_000854759.1 |
| Coordinates | 2384471..2384848 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | S1NM52 |
| Locus tag | QJP62_RS12100 | Protein ID | WP_001295723.1 |
| Coordinates | 2384938..2385306 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP62_RS12065 (2380409) | 2380409..2380585 | - | 177 | Protein_2374 | helix-turn-helix domain-containing protein | - |
| QJP62_RS12070 (2380777) | 2380777..2381523 | - | 747 | WP_001016257.1 | IS21-like element ISEc12 family helper ATPase IstB | - |
| QJP62_RS12075 (2381538) | 2381538..2383079 | - | 1542 | WP_001298859.1 | IS21-like element ISEc12 family transposase | - |
| QJP62_RS12080 (2383538) | 2383538..2383687 | - | 150 | Protein_2377 | hypothetical protein | - |
| QJP62_RS12085 (2383793) | 2383793..2383969 | - | 177 | WP_000839286.1 | DUF957 domain-containing protein | - |
| QJP62_RS12090 (2383986) | 2383986..2384474 | - | 489 | WP_000761690.1 | DUF5983 family protein | - |
| QJP62_RS12095 (2384471) | 2384471..2384848 | - | 378 | WP_000854759.1 | TA system toxin CbtA family protein | Toxin |
| QJP62_RS12100 (2384938) | 2384938..2385306 | - | 369 | WP_001295723.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QJP62_RS12105 (2385469) | 2385469..2385690 | - | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| QJP62_RS12110 (2385753) | 2385753..2386229 | - | 477 | WP_001186775.1 | RadC family protein | - |
| QJP62_RS12115 (2386245) | 2386245..2386718 | - | 474 | WP_001350782.1 | antirestriction protein | - |
| QJP62_RS12120 (2387060) | 2387060..2387878 | - | 819 | WP_001234738.1 | DUF932 domain-containing protein | - |
| QJP62_RS12125 (2387996) | 2387996..2388191 | - | 196 | Protein_2386 | DUF905 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 2371597..2399844 | 28247 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14144.26 Da Isoelectric Point: 7.3249
>T279449 WP_000854759.1 NZ_CP124328:c2384848-2384471 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13592.40 Da Isoelectric Point: 6.6255
>AT279449 WP_001295723.1 NZ_CP124328:c2385306-2384938 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J2AEA6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1NM52 |