Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 866203..867034 Replicon chromosome
Accession NZ_CP124328
Organism Escherichia coli strain AVS0787

Toxin (Protein)


Gene name yeeV Uniprot ID A0A066T988
Locus tag QJP62_RS04580 Protein ID WP_000854815.1
Coordinates 866660..867034 (+) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A061Y7A8
Locus tag QJP62_RS04575 Protein ID WP_001280918.1
Coordinates 866203..866571 (+) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP62_RS04530 (861292) 861292..862038 + 747 WP_001016257.1 IS21-like element ISEc12 family helper ATPase IstB -
QJP62_RS04535 (862121) 862121..862471 + 351 Protein_895 hypothetical protein -
QJP62_RS04540 (862487) 862487..862897 + 411 WP_000846703.1 hypothetical protein -
QJP62_RS04545 (863118) 863118..863936 + 819 WP_001542275.1 DUF932 domain-containing protein -
QJP62_RS04550 (863936) 863936..864181 + 246 WP_001164966.1 hypothetical protein -
QJP62_RS04555 (864275) 864275..864748 + 474 WP_001542276.1 antirestriction protein -
QJP62_RS04560 (864764) 864764..865240 + 477 WP_001186200.1 RadC family protein -
QJP62_RS04565 (865303) 865303..865524 + 222 WP_000692345.1 DUF987 domain-containing protein -
QJP62_RS04570 (865543) 865543..866187 + 645 WP_000086752.1 hypothetical protein -
QJP62_RS04575 (866203) 866203..866571 + 369 WP_001280918.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
QJP62_RS04580 (866660) 866660..867034 + 375 WP_000854815.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
QJP62_RS04585 (867031) 867031..867225 + 195 WP_000988600.1 DUF5983 family protein -
QJP62_RS04590 (867271) 867271..867351 + 81 Protein_906 hypothetical protein -
QJP62_RS04595 (867640) 867640..867720 - 81 WP_023441679.1 hypothetical protein -
QJP62_RS04600 (867699) 867699..868022 + 324 WP_225469267.1 EutP/PduV family microcompartment system protein -
QJP62_RS04605 (868123) 868123..868452 - 330 WP_000450409.1 DUF496 family protein -
QJP62_RS04610 (868624) 868624..869682 - 1059 WP_001200889.1 FUSC family protein -
QJP62_RS04615 (869880) 869880..870353 - 474 WP_001105368.1 DNA gyrase inhibitor SbmC -
QJP62_RS04620 (870472) 870472..871638 - 1167 WP_001296209.1 serine-type D-Ala-D-Ala carboxypeptidase DacD -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 804664..914938 110274


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(19-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13829.83 Da        Isoelectric Point: 7.1326

>T279442 WP_000854815.1 NZ_CP124328:866660-867034 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTSDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13811.70 Da        Isoelectric Point: 6.4767

>AT279442 WP_001280918.1 NZ_CP124328:866203-866571 [Escherichia coli]
VSDKLHETNYPDDHNDRLWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A066T988

Antitoxin

Source ID Structure
AlphaFold DB A0A061Y7A8

References