Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 4224992..4225826 | Replicon | chromosome |
Accession | NZ_CP124322 | ||
Organism | Escherichia coli strain AVS0717 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | A0A1J6XFW9 |
Locus tag | QJB10_RS20655 | Protein ID | WP_000854770.1 |
Coordinates | 4224992..4225369 (-) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | A0A1M1N885 |
Locus tag | QJB10_RS20660 | Protein ID | WP_001280950.1 |
Coordinates | 4225458..4225826 (-) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QJB10_RS20630 (4221103) | 4221103..4222725 | - | 1623 | WP_001295726.1 | Alw26I/Eco31I/Esp3I family type II restriction adenine-specific DNA-methyltransferase | - |
QJB10_RS20635 (4223516) | 4223516..4223692 | - | 177 | Protein_4048 | helix-turn-helix domain-containing protein | - |
QJB10_RS20640 (4224059) | 4224059..4224208 | - | 150 | Protein_4049 | hypothetical protein | - |
QJB10_RS20645 (4224314) | 4224314..4224490 | - | 177 | WP_000839286.1 | DUF957 domain-containing protein | - |
QJB10_RS20650 (4224507) | 4224507..4224995 | - | 489 | WP_000761690.1 | DUF5983 family protein | - |
QJB10_RS20655 (4224992) | 4224992..4225369 | - | 378 | WP_000854770.1 | TA system toxin CbtA family protein | Toxin |
QJB10_RS20660 (4225458) | 4225458..4225826 | - | 369 | WP_001280950.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
QJB10_RS20665 (4225989) | 4225989..4226210 | - | 222 | WP_001220314.1 | DUF987 domain-containing protein | - |
QJB10_RS20670 (4226273) | 4226273..4226749 | - | 477 | WP_001186779.1 | RadC family protein | - |
QJB10_RS20675 (4226765) | 4226765..4227229 | - | 465 | WP_000855061.1 | antirestriction protein | - |
QJB10_RS20680 (4227571) | 4227571..4228389 | - | 819 | WP_001234712.1 | DUF932 domain-containing protein | - |
QJB10_RS20685 (4228507) | 4228507..4228702 | - | 196 | Protein_4058 | DUF905 family protein | - |
QJB10_RS20690 (4228773) | 4228773..4230674 | - | 1902 | Protein_4059 | Ag43/Cah family autotransporter adhesin | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 4213346..4253555 | 40209 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14196.37 Da Isoelectric Point: 8.7438
>T279390 WP_000854770.1 NZ_CP124322:c4225369-4224992 [Escherichia coli]
MKTLPDTHVRKVSRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
MKTLPDTHVRKVSRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13737.56 Da Isoelectric Point: 7.0268
>AT279390 WP_001280950.1 NZ_CP124322:c4225826-4225458 [Escherichia coli]
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAFYPTSETKK
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAFYPTSETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1J6XFW9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1M1N885 |