Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN-MazE |
| Location | 76039..76651 | Replicon | plasmid pLX02 |
| Accession | NZ_CP123976 | ||
| Organism | Thioclava nitratireducens strain M1-LQ-LJL-11 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | P0N61_RS20595 | Protein ID | WP_088726100.1 |
| Coordinates | 76256..76651 (+) | Length | 132 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A1M7KKN2 |
| Locus tag | P0N61_RS20590 | Protein ID | WP_009815510.1 |
| Coordinates | 76039..76266 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P0N61_RS20575 (P0N61_20575) | 71646..72962 | - | 1317 | WP_088726103.1 | plasmid replication protein RepC | - |
| P0N61_RS20580 (P0N61_20580) | 73182..74129 | - | 948 | WP_240504181.1 | plasmid partitioning protein RepB | - |
| P0N61_RS20585 (P0N61_20585) | 74153..75337 | - | 1185 | WP_088726101.1 | plasmid partitioning protein RepA | - |
| P0N61_RS20590 (P0N61_20590) | 76039..76266 | + | 228 | WP_009815510.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| P0N61_RS20595 (P0N61_20595) | 76256..76651 | + | 396 | WP_088726100.1 | PIN domain-containing protein | Toxin |
| P0N61_RS20600 (P0N61_20600) | 76635..77357 | - | 723 | Protein_82 | recombinase family protein | - |
| P0N61_RS20605 (P0N61_20605) | 77505..79139 | + | 1635 | WP_024099411.1 | Mu transposase C-terminal domain-containing protein | - |
| P0N61_RS20610 (P0N61_20610) | 79141..80022 | + | 882 | WP_024099410.1 | TniB family NTP-binding protein | - |
| P0N61_RS20615 (P0N61_20615) | 80019..80810 | + | 792 | WP_007803196.1 | TniQ family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..131650 | 131650 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 132 a.a. Molecular weight: 14335.29 Da Isoelectric Point: 4.2057
>T279295 WP_088726100.1 NZ_CP123976:76256-76651 [Thioclava nitratireducens]
MSAEFADTNVVLYLLDDGAKAERAEEILGQGPRVSVQVLNETMVNCRRKAGLSWEDTGAILEAIQSLCPVEDLTVQTHQV
GRALAEKYQLSVYDAMIVSAALIAGCTTLWTEDTHDGLLVEDRLRIVNPFA
MSAEFADTNVVLYLLDDGAKAERAEEILGQGPRVSVQVLNETMVNCRRKAGLSWEDTGAILEAIQSLCPVEDLTVQTHQV
GRALAEKYQLSVYDAMIVSAALIAGCTTLWTEDTHDGLLVEDRLRIVNPFA
Download Length: 396 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|