Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tsbAT/- |
Location | 123115..123891 | Replicon | chromosome |
Accession | NZ_CP123853 | ||
Organism | Staphylococcus aureus strain FDA209P |
Toxin (Protein)
Gene name | tsbT | Uniprot ID | X5E2E6 |
Locus tag | NUG19_RS00775 | Protein ID | WP_000031108.1 |
Coordinates | 123739..123891 (+) | Length | 51 a.a. |
Antitoxin (Protein)
Gene name | tsbA | Uniprot ID | W8U4V4 |
Locus tag | NUG19_RS00770 | Protein ID | WP_001251224.1 |
Coordinates | 123115..123714 (+) | Length | 200 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NUG19_RS00750 (119030) | 119030..120487 | + | 1458 | WP_000649907.1 | ABC transporter permease subunit | - |
NUG19_RS00755 (120480) | 120480..121202 | + | 723 | WP_000590809.1 | amino acid ABC transporter ATP-binding protein | - |
NUG19_RS00760 (121354) | 121354..122481 | + | 1128 | WP_258239600.1 | tRNA epoxyqueuosine(34) reductase QueG | - |
NUG19_RS00765 (122486) | 122486..122956 | + | 471 | WP_000181394.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
NUG19_RS00770 (123115) | 123115..123714 | + | 600 | WP_001251224.1 | glucosamine-6-phosphate isomerase | Antitoxin |
NUG19_RS00775 (123739) | 123739..123891 | + | 153 | WP_000031108.1 | SAS053 family protein | Toxin |
NUG19_RS00780 (124435) | 124435..124830 | + | 396 | WP_000901023.1 | hypothetical protein | - |
NUG19_RS00785 (125026) | 125026..126411 | + | 1386 | WP_000116229.1 | class II fumarate hydratase | - |
NUG19_RS00790 (126863) | 126863..127684 | - | 822 | WP_042727629.1 | RluA family pseudouridine synthase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 117412..118731 | 1319 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5936.28 Da Isoelectric Point: 3.8962
>T279182 WP_000031108.1 NZ_CP123853:123739-123891 [Staphylococcus aureus]
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
Download Length: 153 bp
Antitoxin
Download Length: 200 a.a. Molecular weight: 22343.47 Da Isoelectric Point: 5.1445
>AT279182 WP_001251224.1 NZ_CP123853:123115-123714 [Staphylococcus aureus]
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
Download Length: 600 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|