Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 2238565..2239193 Replicon chromosome
Accession NZ_CP123597
Organism Serratia marcescens strain RMCH-M26-N

Toxin (Protein)


Gene name hicA Uniprot ID A0A0P0QK57
Locus tag QFB82_RS10930 Protein ID WP_015378230.1
Coordinates 2238565..2238768 (+) Length 68 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID A0A086GDG8
Locus tag QFB82_RS10935 Protein ID WP_015378231.1
Coordinates 2238780..2239193 (+) Length 138 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QFB82_RS10925 (QFB82_10925) 2234430..2238401 + 3972 WP_082996682.1 trifunctional transcriptional regulator/proline dehydrogenase/L-glutamate gamma-semialdehyde dehydrogenase -
QFB82_RS10930 (QFB82_10930) 2238565..2238768 + 204 WP_015378230.1 type II toxin-antitoxin system HicA family toxin Toxin
QFB82_RS10935 (QFB82_10935) 2238780..2239193 + 414 WP_015378231.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
QFB82_RS10940 (QFB82_10940) 2239223..2239975 - 753 WP_015378232.1 L-cystine ABC transporter ATP-binding protein TcyN -
QFB82_RS10945 (QFB82_10945) 2239979..2240641 - 663 WP_015378233.1 cystine ABC transporter permease -
QFB82_RS10950 (QFB82_10950) 2240641..2241441 - 801 WP_015378234.1 cystine ABC transporter substrate-binding protein -
QFB82_RS10955 (QFB82_10955) 2241557..2242549 - 993 WP_048323979.1 D-cysteine desulfhydrase -
QFB82_RS10960 (QFB82_10960) 2242676..2243185 - 510 WP_004934751.1 flagella biosynthesis regulatory protein FliZ -
QFB82_RS10965 (QFB82_10965) 2243240..2243962 - 723 WP_004934752.1 RNA polymerase sigma factor FliA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - fliZ / fliA 2232375..2243962 11587


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(4-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(3-129)


Sequences

Toxin        


Download         Length: 68 a.a.        Molecular weight: 7523.89 Da        Isoelectric Point: 11.1475

>T279055 WP_015378230.1 NZ_CP123597:2238565-2238768 [Serratia marcescens]
VKSSELIALLESHGWVLRRVKGSHHQFKHPDFALIITVPHPKKDLKLGTLRQILKDAGLSALHIATR

Download         Length: 204 bp

Antitoxin


Download         Length: 138 a.a.        Molecular weight: 14888.63 Da        Isoelectric Point: 5.4867

>AT279055 WP_015378231.1 NZ_CP123597:2238780-2239193 [Serratia marcescens]
MFYPAYIHTESNGSASGFFPDVPGCYFAGTSLDDAFADAQSALDAHFELLSEDNQPLPRPHAVAAHLAKDAGSFEGGQWL
LVAINMDKFDGRAERINITLPHRLLSRIDSLVRQHPGYGSRSGFLAAAARNELLKAE

Download         Length: 414 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0P0QK57

Antitoxin

Source ID Structure
AlphaFold DB A0A086GDG8

References