Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 797304..797851 | Replicon | chromosome |
| Accession | NZ_CP123597 | ||
| Organism | Serratia marcescens strain RMCH-M26-N | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | A0A086G3V8 |
| Locus tag | QFB82_RS04100 | Protein ID | WP_033633716.1 |
| Coordinates | 797543..797851 (+) | Length | 103 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | A0A0G3SUU9 |
| Locus tag | QFB82_RS04095 | Protein ID | WP_033633717.1 |
| Coordinates | 797304..797540 (+) | Length | 79 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QFB82_RS04080 (QFB82_04080) | 793790..795325 | + | 1536 | WP_060559031.1 | glutathione ABC transporter substrate-binding protein GsiB | - |
| QFB82_RS04085 (QFB82_04085) | 795378..796298 | + | 921 | WP_060559032.1 | glutathione ABC transporter permease GsiC | - |
| QFB82_RS04090 (QFB82_04090) | 796308..797216 | + | 909 | WP_019454428.1 | glutathione ABC transporter permease GsiD | - |
| QFB82_RS04095 (QFB82_04095) | 797304..797540 | + | 237 | WP_033633717.1 | type II toxin-antitoxin system CcdA family antitoxin | Antitoxin |
| QFB82_RS04100 (QFB82_04100) | 797543..797851 | + | 309 | WP_033633716.1 | CcdB family protein | Toxin |
| QFB82_RS04105 (QFB82_04105) | 797888..798730 | - | 843 | WP_015377214.1 | S-formylglutathione hydrolase | - |
| QFB82_RS04110 (QFB82_04110) | 798745..799869 | - | 1125 | WP_015377215.1 | S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase | - |
| QFB82_RS04115 (QFB82_04115) | 799899..800819 | - | 921 | WP_280598107.1 | LysR substrate-binding domain-containing protein | - |
| QFB82_RS04120 (QFB82_04120) | 800925..802082 | + | 1158 | WP_031299819.1 | YbfB/YjiJ family MFS transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11448.21 Da Isoelectric Point: 5.0196
>T279050 WP_033633716.1 NZ_CP123597:797543-797851 [Serratia marcescens]
MQFTVYDNTYPASAYPYLLDVQSDLIDALSTRLMIPLYALDNVRVKISARLCPEIEVNGEKFLVMTHEMAAVRISQLGKA
VGNANEHRNQIKAAIDFLIDGF
MQFTVYDNTYPASAYPYLLDVQSDLIDALSTRLMIPLYALDNVRVKISARLCPEIEVNGEKFLVMTHEMAAVRISQLGKA
VGNANEHRNQIKAAIDFLIDGF
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A086G3V8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0G3SUU9 |