Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VagC
Location 40372..41008 Replicon plasmid paNv_CH3
Accession NZ_CP123547
Organism Arsenophonus nasoniae strain aNv_CH

Toxin (Protein)


Gene name vapC Uniprot ID A0A4P7L2E3
Locus tag QE197_RS22195 Protein ID WP_026823396.1
Coordinates 40372..40776 (-) Length 135 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID A0A4P7L1M6
Locus tag QE197_RS22200 Protein ID WP_026823397.1
Coordinates 40769..41008 (-) Length 80 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QE197_RS22155 (QE197_22150) 36143..36271 - 129 WP_280632022.1 hypothetical protein -
QE197_RS22160 (QE197_22155) 36399..36767 - 369 WP_026823391.1 hypothetical protein -
QE197_RS22165 (QE197_22160) 36745..37338 - 594 WP_026823392.1 hypothetical protein -
QE197_RS22170 (QE197_22165) 37341..38096 - 756 WP_135678964.1 signal peptidase I -
QE197_RS22175 38145..38579 - 435 WP_026823394.1 hypothetical protein -
QE197_RS22180 (QE197_22170) 38581..38757 - 177 WP_167876777.1 hypothetical protein -
QE197_RS22185 (QE197_22175) 38807..38965 - 159 WP_155846998.1 hypothetical protein -
QE197_RS22190 (QE197_22180) 38962..39927 - 966 WP_051297076.1 tyrosine-type recombinase/integrase -
QE197_RS22195 (QE197_22185) 40372..40776 - 405 WP_026823396.1 type II toxin-antitoxin system VapC family toxin Toxin
QE197_RS22200 (QE197_22190) 40769..41008 - 240 WP_026823397.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
QE197_RS22205 (QE197_22195) 41115..41498 - 384 WP_026823398.1 hypothetical protein -
QE197_RS22210 (QE197_22200) 41516..42205 - 690 WP_026823399.1 hypothetical protein -
QE197_RS22215 (QE197_22205) 42657..43816 + 1160 WP_135677411.1 IS3 family transposase -
QE197_RS22220 (QE197_22210) 43806..44860 + 1055 Protein_56 IS21 family transposase -
QE197_RS22225 (QE197_22215) 44847..45608 + 762 WP_135677409.1 IS21-like element helper ATPase IstB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..137510 137510
- flank IS/Tn - - 42657..42971 314


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(4-124)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 135 a.a.        Molecular weight: 15217.49 Da        Isoelectric Point: 8.5036

>T279034 WP_026823396.1 NZ_CP123547:c40776-40372 [Arsenophonus nasoniae]
MIKYLLDTNIVIFTIKRKPVSLLPKFNQHTNQLAISAITFAELIFGAEKSMNSAKNLATVNDFVSRLTVLPYDEQAAFHY
GDIKANFEKKEKPIGDNDLHIAAHARSKGLVVVTNNTREFERVEGLRIEDWTQL

Download         Length: 405 bp

Antitoxin


Download         Length: 80 a.a.        Molecular weight: 9195.27 Da        Isoelectric Point: 4.7420

>AT279034 WP_026823397.1 NZ_CP123547:c41008-40769 [Arsenophonus nasoniae]
MIQQGKVFMSNRTQNVRLPADTRFPDDVKDVIVRVKGKERIISPVQNAWDSFFLSEQSVTDDFLSNRTEQITSERESFD

Download         Length: 240 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7L2E3

Antitoxin

Source ID Structure
AlphaFold DB A0A4P7L1M6

References