Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 2079617..2080271 | Replicon | chromosome |
| Accession | NZ_CP123498 | ||
| Organism | Arsenophonus nasoniae strain aIh | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A4P7L3M1 |
| Locus tag | QE207_RS12050 | Protein ID | WP_026821813.1 |
| Coordinates | 2079617..2080024 (-) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | A0A4P7KWA0 |
| Locus tag | QE207_RS12055 | Protein ID | WP_026821812.1 |
| Coordinates | 2080005..2080271 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QE207_RS12035 (QE207_12025) | 2075001..2076764 | + | 1764 | WP_280628737.1 | hypothetical protein | - |
| QE207_RS12040 (QE207_12030) | 2077284..2078597 | + | 1314 | WP_280628738.1 | S8 family serine peptidase | - |
| QE207_RS12045 (QE207_12035) | 2079083..2079601 | + | 519 | WP_026821814.1 | flavodoxin FldB | - |
| QE207_RS12050 (QE207_12040) | 2079617..2080024 | - | 408 | WP_026821813.1 | protein YgfX | Toxin |
| QE207_RS12055 (QE207_12045) | 2080005..2080271 | - | 267 | WP_026821812.1 | FAD assembly factor SdhE | Antitoxin |
| QE207_RS12060 (QE207_12050) | 2080531..2081517 | + | 987 | WP_280628739.1 | tRNA-modifying protein YgfZ | - |
| QE207_RS12065 (QE207_12055) | 2082372..2082710 | - | 339 | WP_280628740.1 | hypothetical protein | - |
| QE207_RS12070 (QE207_12060) | 2082955..2083434 | - | 480 | WP_280628741.1 | hypothetical protein | - |
| QE207_RS12075 (QE207_12065) | 2083425..2083790 | - | 366 | WP_280628742.1 | hypothetical protein | - |
| QE207_RS12080 (QE207_12070) | 2083882..2084388 | - | 507 | WP_280628743.1 | hypothetical protein | - |
| QE207_RS12085 (QE207_12075) | 2084385..2084738 | - | 354 | WP_280628744.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 15888.82 Da Isoelectric Point: 10.8101
>T279005 WP_026821813.1 NZ_CP123498:c2080024-2079617 [Arsenophonus nasoniae]
VVLWKFNINVSWLTQLFSTGVHVGIGLLVFFSSWPPNNLVTWLIATLLIVASWVRSQKNISRCKGSIVLLNGNKIQWKKS
EWLIVKKPWFCFFGVKLTLRSWQCNKRIRLWIASDSMPEEEWRNLNQLLLQYPDI
VVLWKFNINVSWLTQLFSTGVHVGIGLLVFFSSWPPNNLVTWLIATLLIVASWVRSQKNISRCKGSIVLLNGNKIQWKKS
EWLIVKKPWFCFFGVKLTLRSWQCNKRIRLWIASDSMPEEEWRNLNQLLLQYPDI
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4P7L3M1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4P7KWA0 |