Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PRK09907-MazE
Location 155593..156170 Replicon plasmid p15628A_320
Accession NZ_CP123373
Organism Providencia rettgeri strain PreM15628

Toxin (Protein)


Gene name mazF Uniprot ID -
Locus tag KOF27_RS20710 Protein ID WP_283656819.1
Coordinates 155593..155925 (-) Length 111 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID -
Locus tag KOF27_RS20715 Protein ID WP_096864992.1
Coordinates 155925..156170 (-) Length 82 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
KOF27_RS20675 (KOF27_20975) 151437..152252 - 816 WP_283656823.1 DUF4365 domain-containing protein -
KOF27_RS20680 (KOF27_20980) 152268..153221 - 954 WP_283656822.1 site-specific integrase -
KOF27_RS20685 (KOF27_20985) 153515..153808 + 294 WP_283658080.1 hypothetical protein -
KOF27_RS20690 (KOF27_20990) 153823..154077 + 255 WP_283656821.1 hypothetical protein -
KOF27_RS20695 (KOF27_20995) 154173..154631 + 459 WP_283656820.1 hypothetical protein -
KOF27_RS20700 (KOF27_21000) 154952..155095 + 144 WP_071547955.1 Hok/Gef family protein -
KOF27_RS20705 (KOF27_21005) 155182..155562 - 381 WP_096864991.1 hypothetical protein -
KOF27_RS20710 (KOF27_21010) 155593..155925 - 333 WP_283656819.1 endoribonuclease MazF Toxin
KOF27_RS20715 (KOF27_21015) 155925..156170 - 246 WP_096864992.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Antitoxin
KOF27_RS20720 (KOF27_21020) 156497..157120 + 624 WP_023159958.1 AAA family ATPase -
KOF27_RS20725 (KOF27_21025) 157229..157456 + 228 WP_283656818.1 plasmid partition protein ParG -
KOF27_RS20730 (KOF27_21030) 157554..157922 - 369 WP_283656817.1 hypothetical protein -
KOF27_RS20735 (KOF27_21035) 158681..159259 - 579 WP_048822182.1 hypothetical protein -
KOF27_RS20740 (KOF27_21040) 159268..159747 - 480 WP_048821772.1 Hcp family type VI secretion system effector -
KOF27_RS20745 (KOF27_21045) 160027..160419 - 393 WP_283656816.1 hypothetical protein -
KOF27_RS20750 (KOF27_21050) 160429..160851 - 423 WP_283656815.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid mph(E) / msr(E) / blaPER-2 / aph(3')-VI / blaNDM-1 / qnrD1 / aph(3')-Ia / sul1 / qacE / ARR-3 / catB3 / blaOXA-1 / aac(6')-Ib-cr / sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / floR groEL 1..319669 319669


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(9-107)

Antitoxin

SpoVT-AbrB domain

(7-49)


Sequences

Toxin        


Download         Length: 111 a.a.        Molecular weight: 12083.81 Da        Isoelectric Point: 6.4472

>T278968 WP_283656819.1 NZ_CP123373:c155925-155593 [Providencia rettgeri]
MVSRYVPDSGDLIWIDFDPVEGHEQGGHRPAVVLSPFAYNNKVGLLLCVPCTTKGKGYPFECELSNERDSYALADQVTCV
DWRARNVTKKGKVEASELAEIKAKAKALIG

Download         Length: 333 bp

Antitoxin


Download         Length: 82 a.a.        Molecular weight: 8800.23 Da        Isoelectric Point: 5.0508

>AT278968 WP_096864992.1 NZ_CP123373:c156170-155925 [Providencia rettgeri]
MAQVTVKKWGNSPSVRLPVAIMQKAALSVDDTVEIAVEEGRIIITPVKAVEYSLENLLAGITPENIHEKVDFGARTGKEL
I

Download         Length: 246 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References