Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 2710580..2711361 | Replicon | chromosome |
| Accession | NZ_CP123280 | ||
| Organism | Salmonella sp. SA17155 | ||
Toxin (Protein)
| Gene name | TacT2 | Uniprot ID | E8X9W8 |
| Locus tag | QEN30_RS13790 | Protein ID | WP_000626099.1 |
| Coordinates | 2710580..2711071 (-) | Length | 164 a.a. |
Antitoxin (Protein)
| Gene name | TacA2 | Uniprot ID | B5R979 |
| Locus tag | QEN30_RS13795 | Protein ID | WP_001110452.1 |
| Coordinates | 2711068..2711361 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QEN30_RS13750 (2705766) | 2705766..2706008 | - | 243 | WP_197603740.1 | hypothetical protein | - |
| QEN30_RS13755 (2706005) | 2706005..2706361 | - | 357 | WP_033567083.1 | hypothetical protein | - |
| QEN30_RS13760 (2706358) | 2706358..2707230 | - | 873 | WP_033567082.1 | ParA family protein | - |
| QEN30_RS13765 (2707421) | 2707421..2707498 | - | 78 | Protein_2690 | helix-turn-helix domain-containing protein | - |
| QEN30_RS13770 (2707589) | 2707589..2707921 | - | 333 | WP_001165471.1 | MerR family transcriptional regulator | - |
| QEN30_RS13775 (2707993) | 2707993..2708370 | + | 378 | WP_000916345.1 | EthD family reductase | - |
| QEN30_RS13780 (2709403) | 2709403..2709477 | + | 75 | Protein_2693 | porin family protein | - |
| QEN30_RS13785 (2709580) | 2709580..2710332 | + | 753 | WP_000842434.1 | non-specific acid phosphatase | - |
| QEN30_RS13790 (2710580) | 2710580..2711071 | - | 492 | WP_000626099.1 | GNAT family N-acetyltransferase | Toxin |
| QEN30_RS13795 (2711068) | 2711068..2711361 | - | 294 | WP_001110452.1 | DUF1778 domain-containing protein | Antitoxin |
| QEN30_RS13800 (2711678) | 2711678..2711899 | + | 222 | WP_001576552.1 | hypothetical protein | - |
| QEN30_RS13805 (2712164) | 2712164..2713039 | + | 876 | WP_000921674.1 | AraC family transcriptional regulator | - |
| QEN30_RS13810 (2713036) | 2713036..2713323 | + | 288 | WP_001269916.1 | transcriptional regulator RtsB | - |
| QEN30_RS13815 (2713346) | 2713346..2713561 | + | 216 | WP_001595136.1 | hypothetical protein | - |
| QEN30_RS13820 (2713569) | 2713569..2713838 | + | 270 | WP_010989096.1 | hypothetical protein | - |
| QEN30_RS13825 (2714132) | 2714132..2715037 | - | 906 | WP_001268200.1 | YjiK family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17646.39 Da Isoelectric Point: 6.8437
>T278887 WP_000626099.1 NZ_CP123280:c2711071-2710580 [Salmonella sp. SA17155]
MISTPEPLHAGHILTPFCCGVDSIDNWLEQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPVVVLGRLAVDKSLHGQGVARALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
MISTPEPLHAGHILTPFCCGVDSIDNWLEQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPVVVLGRLAVDKSLHGQGVARALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
Download Length: 492 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 7AK7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 7AK7 | |
| AlphaFold DB | A0A5I1DGA4 |