Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1867022..1867853 Replicon chromosome
Accession NZ_CP123266
Organism Escherichia coli strain YZLc23-1

Toxin (Protein)


Gene name yeeV Uniprot ID -
Locus tag N4686_RS08945 Protein ID WP_112917612.1
Coordinates 1867022..1867396 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID -
Locus tag N4686_RS08950 Protein ID WP_032261140.1
Coordinates 1867485..1867853 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N4686_RS08905 (1862418) 1862418..1863584 + 1167 WP_000830170.1 serine-type D-Ala-D-Ala carboxypeptidase DacD -
N4686_RS08910 (1863703) 1863703..1864176 + 474 WP_001105416.1 DNA gyrase inhibitor SbmC -
N4686_RS08915 (1864374) 1864374..1865432 + 1059 WP_001200890.1 FUSC family protein -
N4686_RS08920 (1865604) 1865604..1865933 + 330 WP_000450409.1 DUF496 family protein -
N4686_RS08925 (1866034) 1866034..1866357 - 324 WP_223216378.1 EutP/PduV family microcompartment system protein -
N4686_RS08930 (1866336) 1866336..1866416 + 81 WP_023441679.1 hypothetical protein -
N4686_RS08935 (1866705) 1866705..1866785 - 81 Protein_1746 hypothetical protein -
N4686_RS08940 (1866831) 1866831..1867025 - 195 WP_000988600.1 DUF5983 family protein -
N4686_RS08945 (1867022) 1867022..1867396 - 375 WP_112917612.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
N4686_RS08950 (1867485) 1867485..1867853 - 369 WP_032261140.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
N4686_RS08955 (1867927) 1867927..1868148 - 222 WP_000692320.1 DUF987 domain-containing protein -
N4686_RS08960 (1868211) 1868211..1868687 - 477 WP_001186773.1 RadC family protein -
N4686_RS08965 (1868703) 1868703..1869182 - 480 WP_000860076.1 antirestriction protein -
N4686_RS08970 (1869264) 1869264..1870085 - 822 WP_097412419.1 DUF932 domain-containing protein -
N4686_RS08975 (1870306) 1870306..1870716 - 411 WP_000846713.1 hypothetical protein -
N4686_RS08980 (1870732) 1870732..1871415 - 684 WP_000775500.1 hypothetical protein -
N4686_RS08985 (1871551) 1871551..1872621 - 1071 WP_000102643.1 patatin-like phospholipase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13853.95 Da        Isoelectric Point: 8.5190

>T278852 WP_112917612.1 NZ_CP123266:c1867396-1867022 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLGQHYGLTLDDTPFADERVIEQHIKAGISLCDAVNFLVEKYTLVRTDQPGF
SACTHSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEVK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13682.60 Da        Isoelectric Point: 6.6209

>AT278852 WP_032261140.1 NZ_CP123266:c1867853-1867485 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRACIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References