Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 78995..79248 | Replicon | plasmid pYZMc17-1_NDM-5_80K |
| Accession | NZ_CP123257 | ||
| Organism | Escherichia coli strain YZMc17-1 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | N4680_RS24525 | Protein ID | WP_001312851.1 |
| Coordinates | 79099..79248 (+) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 78995..79054 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N4680_RS24500 (75722) | 75722..76468 | + | 747 | WP_000205770.1 | conjugal transfer pilus acetylase TraX | - |
| N4680_RS24505 (76523) | 76523..77083 | + | 561 | WP_000139328.1 | fertility inhibition protein FinO | - |
| N4680_RS24510 (77215) | 77215..77415 | + | 201 | WP_015059022.1 | hypothetical protein | - |
| N4680_RS24515 (77801) | 77801..78400 | + | 600 | WP_032083981.1 | PIN domain-containing protein | - |
| N4680_RS24520 (78462) | 78462..78794 | + | 333 | WP_152916585.1 | hypothetical protein | - |
| - (78995) | 78995..79054 | - | 60 | NuclAT_1 | - | Antitoxin |
| - (78995) | 78995..79054 | - | 60 | NuclAT_1 | - | Antitoxin |
| - (78995) | 78995..79054 | - | 60 | NuclAT_1 | - | Antitoxin |
| - (78995) | 78995..79054 | - | 60 | NuclAT_1 | - | Antitoxin |
| N4680_RS24525 (79099) | 79099..79248 | + | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| N4680_RS24530 (79532) | 79532..79780 | + | 249 | WP_000083837.1 | replication regulatory protein RepA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaNDM-5 / blaTEM-1B / rmtB | - | 1..80091 | 80091 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T278817 WP_001312851.1 NZ_CP123257:79099-79248 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 60 bp
>AT278817 NZ_CP123257:c79054-78995 [Escherichia coli]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|