Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4196306..4197104 | Replicon | chromosome |
| Accession | NZ_CP123255 | ||
| Organism | Escherichia coli strain YZMc17-1 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A1X1M0U2 |
| Locus tag | N4680_RS20320 | Protein ID | WP_000854919.1 |
| Coordinates | 4196306..4196683 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | N4680_RS20325 | Protein ID | WP_061090819.1 |
| Coordinates | 4196730..4197104 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N4680_RS20285 (4191511) | 4191511..4192617 | + | 1107 | WP_001353974.1 | N-acetylneuraminate epimerase | - |
| N4680_RS20290 (4192682) | 4192682..4193662 | + | 981 | WP_001295601.1 | sialate O-acetylesterase | - |
| N4680_RS20295 (4193670) | 4193670..4194320 | - | 651 | WP_001037966.1 | HNH endonuclease | - |
| N4680_RS20300 (4194457) | 4194457..4194600 | + | 144 | Protein_3970 | HNH endonuclease | - |
| N4680_RS20305 (4195376) | 4195376..4195519 | - | 144 | Protein_3971 | hypothetical protein | - |
| N4680_RS20310 (4195604) | 4195604..4195801 | - | 198 | WP_001327226.1 | DUF957 domain-containing protein | - |
| N4680_RS20315 (4195821) | 4195821..4196309 | - | 489 | WP_061090820.1 | DUF5983 family protein | - |
| N4680_RS20320 (4196306) | 4196306..4196683 | - | 378 | WP_000854919.1 | TA system toxin CbtA family protein | Toxin |
| N4680_RS20325 (4196730) | 4196730..4197104 | - | 375 | WP_061090819.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| N4680_RS20330 (4197267) | 4197267..4197488 | - | 222 | WP_000692323.1 | DUF987 domain-containing protein | - |
| N4680_RS20335 (4197551) | 4197551..4198027 | - | 477 | WP_001186771.1 | RadC family protein | - |
| N4680_RS20340 (4198043) | 4198043..4198522 | - | 480 | WP_001703514.1 | antirestriction protein | - |
| N4680_RS20345 (4198604) | 4198604..4199422 | - | 819 | WP_001234688.1 | DUF932 domain-containing protein | - |
| N4680_RS20350 (4199608) | 4199608..4200492 | - | 885 | WP_000010380.1 | YfjP family GTPase | - |
| N4680_RS20355 (4200593) | 4200593..4201816 | + | 1224 | WP_061090817.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | fimB | 4188719..4225005 | 36286 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14037.97 Da Isoelectric Point: 7.9086
>T278812 WP_000854919.1 NZ_CP123255:c4196683-4196306 [Escherichia coli]
MKTLSDTHVREVSRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGTSSQLINSIDILRARRATGLMTRSNYRTVNNITLGKHPEAKQ
MKTLSDTHVREVSRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGTSSQLINSIDILRARRATGLMTRSNYRTVNNITLGKHPEAKQ
Download Length: 378 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 13698.52 Da Isoelectric Point: 6.4757
>AT278812 WP_061090819.1 NZ_CP123255:c4197104-4196730 [Escherichia coli]
VSDKLSGITHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPAPAITS
VSDKLSGITHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPAPAITS
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|