Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 751166..751964 | Replicon | chromosome |
| Accession | NZ_CP123255 | ||
| Organism | Escherichia coli strain YZMc17-1 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | U9XMP3 |
| Locus tag | N4680_RS03685 | Protein ID | WP_000854735.1 |
| Coordinates | 751166..751543 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A1M1EW42 |
| Locus tag | N4680_RS03690 | Protein ID | WP_032153712.1 |
| Coordinates | 751590..751964 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N4680_RS03645 (746392) | 746392..747321 | + | 930 | Protein_714 | lipopolysaccharide biosynthesis protein | - |
| N4680_RS03650 (747332) | 747332..748036 | - | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| N4680_RS03655 (748076) | 748076..748396 | - | 321 | Protein_716 | Arm DNA-binding domain-containing protein | - |
| N4680_RS03660 (748860) | 748860..749186 | - | 327 | WP_000779483.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| N4680_RS03665 (749183) | 749183..749446 | - | 264 | WP_025492088.1 | type II toxin-antitoxin system ParD family antitoxin | - |
| N4680_RS03670 (749518) | 749518..750384 | - | 867 | WP_032153714.1 | DUF4942 domain-containing protein | - |
| N4680_RS03675 (750469) | 750469..750666 | - | 198 | WP_000839265.1 | DUF957 domain-containing protein | - |
| N4680_RS03680 (750678) | 750678..751169 | - | 492 | WP_023155722.1 | DUF5983 family protein | - |
| N4680_RS03685 (751166) | 751166..751543 | - | 378 | WP_000854735.1 | TA system toxin CbtA family protein | Toxin |
| N4680_RS03690 (751590) | 751590..751964 | - | 375 | WP_032153712.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
| N4680_RS03695 (752044) | 752044..752265 | - | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| N4680_RS03700 (752334) | 752334..752810 | - | 477 | WP_001186715.1 | RadC family protein | - |
| N4680_RS03705 (752826) | 752826..753311 | - | 486 | WP_032153711.1 | antirestriction protein | - |
| N4680_RS03710 (753403) | 753403..754221 | - | 819 | WP_001234693.1 | DUF932 domain-containing protein | - |
| N4680_RS03715 (754312) | 754312..754521 | - | 210 | WP_023155727.1 | DUF905 family protein | - |
| N4680_RS03720 (754551) | 754551..755228 | - | 678 | WP_023155728.1 | hypothetical protein | - |
| N4680_RS03725 (755347) | 755347..756231 | - | 885 | WP_024166630.1 | 50S ribosome-binding GTPase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / floR | papI / papB | 749183..816341 | 67158 | |
| - | flank | IS/Tn | - | - | 747332..748036 | 704 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14061.07 Da Isoelectric Point: 8.2904
>T278797 WP_000854735.1 NZ_CP123255:c751543-751166 [Escherichia coli]
MKTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ
MKTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ
Download Length: 378 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 13697.51 Da Isoelectric Point: 6.6240
>AT278797 WP_032153712.1 NZ_CP123255:c751964-751590 [Escherichia coli]
VSDTLPGTTHPDDNNDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYMAVYPTLAPATTS
VSDTLPGTTHPDDNNDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYMAVYPTLAPATTS
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | U9XMP3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1M1EW42 |