Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 751166..751964 Replicon chromosome
Accession NZ_CP123255
Organism Escherichia coli strain YZMc17-1

Toxin (Protein)


Gene name yeeV Uniprot ID U9XMP3
Locus tag N4680_RS03685 Protein ID WP_000854735.1
Coordinates 751166..751543 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A1M1EW42
Locus tag N4680_RS03690 Protein ID WP_032153712.1
Coordinates 751590..751964 (-) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N4680_RS03645 (746392) 746392..747321 + 930 Protein_714 lipopolysaccharide biosynthesis protein -
N4680_RS03650 (747332) 747332..748036 - 705 WP_001067855.1 IS6-like element IS26 family transposase -
N4680_RS03655 (748076) 748076..748396 - 321 Protein_716 Arm DNA-binding domain-containing protein -
N4680_RS03660 (748860) 748860..749186 - 327 WP_000779483.1 type II toxin-antitoxin system RelE/ParE family toxin -
N4680_RS03665 (749183) 749183..749446 - 264 WP_025492088.1 type II toxin-antitoxin system ParD family antitoxin -
N4680_RS03670 (749518) 749518..750384 - 867 WP_032153714.1 DUF4942 domain-containing protein -
N4680_RS03675 (750469) 750469..750666 - 198 WP_000839265.1 DUF957 domain-containing protein -
N4680_RS03680 (750678) 750678..751169 - 492 WP_023155722.1 DUF5983 family protein -
N4680_RS03685 (751166) 751166..751543 - 378 WP_000854735.1 TA system toxin CbtA family protein Toxin
N4680_RS03690 (751590) 751590..751964 - 375 WP_032153712.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
N4680_RS03695 (752044) 752044..752265 - 222 WP_000692345.1 DUF987 domain-containing protein -
N4680_RS03700 (752334) 752334..752810 - 477 WP_001186715.1 RadC family protein -
N4680_RS03705 (752826) 752826..753311 - 486 WP_032153711.1 antirestriction protein -
N4680_RS03710 (753403) 753403..754221 - 819 WP_001234693.1 DUF932 domain-containing protein -
N4680_RS03715 (754312) 754312..754521 - 210 WP_023155727.1 DUF905 family protein -
N4680_RS03720 (754551) 754551..755228 - 678 WP_023155728.1 hypothetical protein -
N4680_RS03725 (755347) 755347..756231 - 885 WP_024166630.1 50S ribosome-binding GTPase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / floR papI / papB 749183..816341 67158
- flank IS/Tn - - 747332..748036 704


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14061.07 Da        Isoelectric Point: 8.2904

>T278797 WP_000854735.1 NZ_CP123255:c751543-751166 [Escherichia coli]
MKTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 13697.51 Da        Isoelectric Point: 6.6240

>AT278797 WP_032153712.1 NZ_CP123255:c751964-751590 [Escherichia coli]
VSDTLPGTTHPDDNNDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYMAVYPTLAPATTS

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB U9XMP3

Antitoxin

Source ID Structure
AlphaFold DB A0A1M1EW42

References