Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 4007658..4008208 Replicon chromosome
Accession NZ_CP123244
Organism Escherichia coli strain YZMc3-1

Toxin (Protein)


Gene name ccdB Uniprot ID Q32K46
Locus tag N4691_RS19065 Protein ID WP_001160974.1
Coordinates 4007658..4007972 (-) Length 105 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V0VEX8
Locus tag N4691_RS19070 Protein ID WP_000125566.1
Coordinates 4007975..4008208 (-) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N4691_RS19040 (4003333) 4003333..4004619 + 1287 WP_000800457.1 peptidylprolyl isomerase SurA -
N4691_RS19045 (4004619) 4004619..4005608 + 990 WP_021556398.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
N4691_RS19050 (4005605) 4005605..4006426 + 822 WP_001065381.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
N4691_RS19055 (4006429) 4006429..4006806 + 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
N4691_RS19060 (4006813) 4006813..4007661 + 849 WP_021556397.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
N4691_RS19065 (4007658) 4007658..4007972 - 315 WP_001160974.1 CcdB family protein Toxin
N4691_RS19070 (4007975) 4007975..4008208 - 234 WP_000125566.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
N4691_RS19075 (4008294) 4008294..4008773 - 480 WP_001487721.1 type 3 dihydrofolate reductase -
N4691_RS19080 (4008965) 4008965..4010827 - 1863 WP_000377191.1 glutathione-regulated potassium-efflux system protein KefC -
N4691_RS19085 (4010820) 4010820..4011350 - 531 WP_000600718.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
N4691_RS19090 (4011461) 4011461..4012792 - 1332 WP_001183198.1 MFS transporter -
N4691_RS19095 (4012850) 4012850..4013137 - 288 WP_000203741.1 ferredoxin-like protein FixX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-103)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11737.84 Da        Isoelectric Point: 9.8517

>T278771 WP_001160974.1 NZ_CP123244:c4007972-4007658 [Escherichia coli]
MQFTVYRSRSRNAAFPFVIDVTSDIIGVINRRIVIPLTPIERFIRIRPPERLNPILLLVDGKEYVLMTHETATVPVNALG
TKFCDASAHRTLIKGALDFMLDGI

Download         Length: 315 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8530.53 Da        Isoelectric Point: 5.8062

>AT278771 WP_000125566.1 NZ_CP123244:c4008208-4007975 [Escherichia coli]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENAEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LRR3

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LTM9

References