Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2505503..2506141 | Replicon | chromosome |
| Accession | NZ_CP123244 | ||
| Organism | Escherichia coli strain YZMc3-1 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | S1F9G9 |
| Locus tag | N4691_RS12005 | Protein ID | WP_000813794.1 |
| Coordinates | 2505965..2506141 (-) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | N4691_RS12000 | Protein ID | WP_001270286.1 |
| Coordinates | 2505503..2505919 (-) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N4691_RS11980 (2500654) | 2500654..2501595 | - | 942 | WP_021556783.1 | ABC transporter permease | - |
| N4691_RS11985 (2501596) | 2501596..2502609 | - | 1014 | WP_021556782.1 | ABC transporter ATP-binding protein | - |
| N4691_RS11990 (2502627) | 2502627..2503772 | - | 1146 | WP_021556781.1 | ABC transporter substrate-binding protein | - |
| N4691_RS11995 (2504018) | 2504018..2505424 | - | 1407 | WP_021556780.1 | PLP-dependent aminotransferase family protein | - |
| N4691_RS12000 (2505503) | 2505503..2505919 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| N4691_RS12005 (2505965) | 2505965..2506141 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| N4691_RS12010 (2506367) | 2506367..2506597 | + | 231 | WP_000494244.1 | YncJ family protein | - |
| N4691_RS12015 (2506689) | 2506689..2508650 | - | 1962 | WP_021556779.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| N4691_RS12020 (2508723) | 2508723..2509259 | - | 537 | WP_021556778.1 | DNA-binding transcriptional regulator SutR | - |
| N4691_RS12025 (2509351) | 2509351..2510526 | + | 1176 | WP_021556777.1 | BenE family transporter YdcO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 2510566..2511714 | 1148 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T278768 WP_000813794.1 NZ_CP123244:c2506141-2505965 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT278768 WP_001270286.1 NZ_CP123244:c2505919-2505503 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|