Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 71216..71859 | Replicon | plasmid pMB11100_2 |
Accession | NZ_CP123233 | ||
Organism | Escherichia coli strain 5132 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | V0UN72 |
Locus tag | QET41_RS25240 | Protein ID | WP_001034044.1 |
Coordinates | 71216..71632 (-) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | B1P7N7 |
Locus tag | QET41_RS25245 | Protein ID | WP_001261286.1 |
Coordinates | 71629..71859 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QET41_RS25225 (QET41_25225) | 67618..68315 | + | 698 | WP_223155668.1 | IS1-like element IS1A family transposase | - |
QET41_RS25230 (QET41_25230) | 68569..69591 | - | 1023 | WP_000361402.1 | helicase UvrD | - |
QET41_RS25235 (QET41_25235) | 69576..71141 | - | 1566 | WP_001128474.1 | AAA family ATPase | - |
QET41_RS25240 (QET41_25240) | 71216..71632 | - | 417 | WP_001034044.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QET41_RS25245 (QET41_25245) | 71629..71859 | - | 231 | WP_001261286.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
QET41_RS25250 (QET41_25250) | 72240..76034 | + | 3795 | WP_001144732.1 | hypothetical protein | - |
QET41_RS25255 (QET41_25255) | 76079..76495 | - | 417 | WP_001034046.1 | type II toxin-antitoxin system VapC family toxin | - |
QET41_RS25260 (QET41_25260) | 76492..76722 | - | 231 | WP_001261278.1 | type II toxin-antitoxin system VapB family antitoxin | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | mph(A) | senB | 1..87114 | 87114 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15232.66 Da Isoelectric Point: 6.8536
>T278698 WP_001034044.1 NZ_CP123233:c71632-71216 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CHW1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CKZ6 |