Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | symE-timR/SymE(toxin) |
Location | 4126310..4126722 | Replicon | chromosome |
Accession | NZ_CP123231 | ||
Organism | Escherichia coli strain 5132 |
Toxin (Protein)
Gene name | symE | Uniprot ID | S1NWQ7 |
Locus tag | QET41_RS20110 | Protein ID | WP_000132614.1 |
Coordinates | 4126381..4126722 (+) | Length | 114 a.a. |
Antitoxin (RNA)
Gene name | timR | ||
Locus tag | - | ||
Coordinates | 4126310..4126386 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QET41_RS20100 (4122922) | 4122922..4124391 | + | 1470 | WP_001387312.1 | type I restriction-modification system subunit M | - |
QET41_RS20105 (4124391) | 4124391..4126160 | + | 1770 | WP_001513535.1 | restriction endonuclease subunit S | - |
- (4126310) | 4126310..4126386 | - | 77 | NuclAT_8 | - | Antitoxin |
- (4126310) | 4126310..4126386 | - | 77 | NuclAT_8 | - | Antitoxin |
- (4126310) | 4126310..4126386 | - | 77 | NuclAT_8 | - | Antitoxin |
- (4126310) | 4126310..4126386 | - | 77 | NuclAT_8 | - | Antitoxin |
- (4126310) | 4126310..4126386 | - | 77 | NuclAT_9 | - | Antitoxin |
- (4126310) | 4126310..4126386 | - | 77 | NuclAT_9 | - | Antitoxin |
- (4126310) | 4126310..4126386 | - | 77 | NuclAT_9 | - | Antitoxin |
- (4126310) | 4126310..4126386 | - | 77 | NuclAT_9 | - | Antitoxin |
QET41_RS20110 (4126381) | 4126381..4126722 | + | 342 | WP_000132614.1 | endoribonuclease SymE | Toxin |
QET41_RS20115 (4126769) | 4126769..4127932 | - | 1164 | WP_224153787.1 | DUF1524 domain-containing protein | - |
QET41_RS20120 (4127986) | 4127986..4128862 | - | 877 | Protein_3938 | DUF262 domain-containing protein | - |
QET41_RS20125 (4129268) | 4129268..4130188 | - | 921 | WP_001513532.1 | Rpn family recombination-promoting nuclease/putative transposase | - |
QET41_RS20130 (4130373) | 4130373..4131653 | + | 1281 | WP_001338077.1 | DUF445 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | cheD | 4110698..4126722 | 16024 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12266.07 Da Isoelectric Point: 8.4982
>T278686 WP_000132614.1 NZ_CP123231:4126381-4126722 [Escherichia coli]
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAAAESE
LMQSLRQVCKLSARKQRQVQEFIGVIAGKQKVA
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAAAESE
LMQSLRQVCKLSARKQRQVQEFIGVIAGKQKVA
Download Length: 342 bp
Antitoxin
Download Length: 77 bp
>AT278686 NZ_CP123231:c4126386-4126310 [Escherichia coli]
AGTCATAACTGCTATTCCCTATAAATAGTGATTGTGATTAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
AGTCATAACTGCTATTCCCTATAAATAGTGATTGTGATTAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|