Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
Location | 767066..767759 | Replicon | chromosome |
Accession | NZ_CP123231 | ||
Organism | Escherichia coli strain 5132 |
Toxin (Protein)
Gene name | mqsR | Uniprot ID | S1EZG2 |
Locus tag | QET41_RS03750 | Protein ID | WP_000415584.1 |
Coordinates | 767066..767362 (+) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | mqsA | Uniprot ID | S1EBV2 |
Locus tag | QET41_RS03755 | Protein ID | WP_000650107.1 |
Coordinates | 767364..767759 (+) | Length | 132 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QET41_RS03715 (762154) | 762154..762468 | - | 315 | WP_000958598.1 | putative quinol monooxygenase | - |
QET41_RS03720 (762499) | 762499..763080 | - | 582 | WP_000065430.1 | NADPH:quinone oxidoreductase MdaB | - |
QET41_RS03725 (763399) | 763399..763731 | + | 333 | WP_000917685.1 | DUF2645 family protein | - |
QET41_RS03730 (763777) | 763777..765126 | - | 1350 | WP_000673402.1 | quorum sensing histidine kinase QseC | - |
QET41_RS03735 (765123) | 765123..765782 | - | 660 | WP_001221493.1 | quorum sensing response regulator transcription factor QseB | - |
QET41_RS03740 (765934) | 765934..766326 | + | 393 | WP_000712658.1 | OB fold stress tolerance protein YgiW | - |
QET41_RS03745 (766379) | 766379..766861 | + | 483 | WP_000183505.1 | GyrI-like domain-containing protein | - |
QET41_RS03750 (767066) | 767066..767362 | + | 297 | WP_000415584.1 | type II toxin-antitoxin system toxin MqsR | Toxin |
QET41_RS03755 (767364) | 767364..767759 | + | 396 | WP_000650107.1 | type II toxin-antitoxin system antitoxin MqsA | Antitoxin |
QET41_RS03760 (767892) | 767892..769499 | + | 1608 | WP_001295629.1 | ABC transporter substrate-binding protein | - |
QET41_RS03765 (769637) | 769637..771895 | + | 2259 | WP_001281841.1 | DNA topoisomerase IV subunit A | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11231.96 Da Isoelectric Point: 8.9070
>T278672 WP_000415584.1 NZ_CP123231:767066-767362 [Escherichia coli]
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
Download Length: 297 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14703.10 Da Isoelectric Point: 9.2136
>AT278672 WP_000650107.1 NZ_CP123231:767364-767759 [Escherichia coli]
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|