Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 43842..44640 | Replicon | chromosome |
| Accession | NZ_CP123231 | ||
| Organism | Escherichia coli strain 5132 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | - |
| Locus tag | QET41_RS00230 | Protein ID | WP_047659684.1 |
| Coordinates | 43842..44219 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | QET41_RS00235 | Protein ID | WP_053289524.1 |
| Coordinates | 44266..44640 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QET41_RS00200 (39216) | 39216..40034 | + | 819 | WP_000779409.1 | lipoprotein NlpA | - |
| QET41_RS00205 (40038) | 40038..40961 | - | 924 | WP_000535950.1 | carboxylate/amino acid/amine transporter | - |
| QET41_RS00210 (41128) | 41128..41625 | - | 498 | WP_000509811.1 | hypothetical protein | - |
| QET41_RS00215 (42221) | 42221..43063 | - | 843 | WP_105495706.1 | DUF4942 domain-containing protein | - |
| QET41_RS00220 (43148) | 43148..43345 | - | 198 | WP_053289522.1 | DUF957 domain-containing protein | - |
| QET41_RS00225 (43357) | 43357..43791 | - | 435 | WP_053289523.1 | DUF5983 family protein | - |
| QET41_RS00230 (43842) | 43842..44219 | - | 378 | WP_047659684.1 | TA system toxin CbtA family protein | Toxin |
| QET41_RS00235 (44266) | 44266..44640 | - | 375 | WP_053289524.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QET41_RS00240 (44720) | 44720..44941 | - | 222 | WP_000692309.1 | DUF987 domain-containing protein | - |
| QET41_RS00245 (45004) | 45004..45480 | - | 477 | WP_053289525.1 | RadC family protein | - |
| QET41_RS00250 (45496) | 45496..45981 | - | 486 | WP_105484384.1 | antirestriction protein | - |
| QET41_RS00255 (46073) | 46073..46891 | - | 819 | WP_105470327.1 | DUF932 domain-containing protein | - |
| QET41_RS00260 (46990) | 46990..47151 | - | 162 | WP_235155994.1 | hypothetical protein | - |
| QET41_RS00265 (47640) | 47640..47918 | - | 279 | WP_001545361.1 | hypothetical protein | - |
| QET41_RS00270 (48179) | 48179..48859 | - | 681 | WP_097505405.1 | WYL domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14089.12 Da Isoelectric Point: 8.2904
>T278669 WP_047659684.1 NZ_CP123231:c44219-43842 [Escherichia coli]
MKTLPDTHVREVSRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ
MKTLPDTHVREVSRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ
Download Length: 378 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 13644.34 Da Isoelectric Point: 5.9467
>AT278669 WP_053289524.1 NZ_CP123231:c44640-44266 [Escherichia coli]
VSDTHPGTTHPDNNNDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELSPRYQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTLAPATTS
VSDTHPGTTHPDNNNDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELSPRYQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTLAPATTS
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|