Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 2890417..2891261 Replicon chromosome
Accession NZ_CP123024
Organism Escherichia coli strain 20-16

Toxin (Protein)


Gene name yeeV Uniprot ID B1LJY4
Locus tag QEN53_RS14100 Protein ID WP_000854686.1
Coordinates 2890417..2890800 (-) Length 128 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A8E0J1S3
Locus tag QEN53_RS14105 Protein ID WP_001285602.1
Coordinates 2890881..2891261 (-) Length 127 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QEN53_RS14060 (2885420) 2885420..2885911 - 492 WP_001297187.1 DUF1097 domain-containing protein -
QEN53_RS14065 (2886013) 2886013..2886567 - 555 WP_001001902.1 molecular chaperone YcdY -
QEN53_RS14070 (2886591) 2886591..2887328 - 738 WP_000283664.1 zinc-binding phosphatase -
QEN53_RS14075 (2887383) 2887383..2888321 - 939 WP_000351311.1 glyoxylate/hydroxypyruvate reductase GhrA -
QEN53_RS14085 (2888792) 2888792..2889633 - 842 Protein_2762 DUF4942 domain-containing protein -
QEN53_RS14090 (2889718) 2889718..2889915 - 198 WP_000839253.1 DUF957 domain-containing protein -
QEN53_RS14095 (2889932) 2889932..2890420 - 489 WP_032180032.1 DUF5983 family protein -
QEN53_RS14100 (2890417) 2890417..2890800 - 384 WP_000854686.1 TA system toxin CbtA family protein Toxin
QEN53_RS14105 (2890881) 2890881..2891261 - 381 WP_001285602.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
QEN53_RS14110 (2891272) 2891272..2891955 - 684 WP_000086768.1 hypothetical protein -
QEN53_RS14115 (2891974) 2891974..2892195 - 222 WP_000692298.1 DUF987 domain-containing protein -
QEN53_RS14120 (2892258) 2892258..2892734 - 477 WP_001186726.1 RadC family protein -
QEN53_RS14125 (2892750) 2892750..2893235 - 486 WP_000214307.1 antirestriction protein -
QEN53_RS14130 (2893327) 2893327..2894148 - 822 WP_001761104.1 DUF932 domain-containing protein -
QEN53_RS14135 (2894249) 2894249..2894457 - 209 Protein_2772 DUF905 family protein -
QEN53_RS14140 (2894558) 2894558..2895013 - 456 WP_000581506.1 IrmA family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-113)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 128 a.a.        Molecular weight: 14272.28 Da        Isoelectric Point: 6.8614

>T278475 WP_000854686.1 NZ_CP123024:c2890800-2890417 [Escherichia coli]
MKTLPDTHVRAASRCPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYVLVRTDQPGF
SAGAPSSQLINSIDILRARRATGLMTRDNYRMVNNITLGKHPEEAKQ

Download         Length: 384 bp

Antitoxin


Download         Length: 127 a.a.        Molecular weight: 13938.69 Da        Isoelectric Point: 5.0823

>AT278475 WP_001285602.1 NZ_CP123024:c2891261-2890881 [Escherichia coli]
VSDTLPGTTLPDDNKDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSNADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCDADTLGSCGYVYLAVYPATETESNPPE

Download         Length: 381 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References